| UniProt ID | FDFT_YEAST | |
|---|---|---|
| UniProt AC | P29704 | |
| Protein Name | Squalene synthase | |
| Gene Name | ERG9 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 444 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Microsome . |
|
| Protein Description | Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol. May also have a regulatory role regulating the flux of isoprene intermediates through the sterol pathway. Squalene synthase is crucial for balancing the incorporation of farnesyl diphosphate (FPP) into sterol and nonsterol isoprene synthesis. ERG9 is also essential for cell growth in yeast.. | |
| Protein Sequence | MGKLLQLALHPVEMKAALKLKFCRTPLFSIYDQSTSPYLLHCFELLNLTSRSFAAVIRELHPELRNCVTLFYLILRALDTIEDDMSIEHDLKIDLLRHFHEKLLLTKWSFDGNAPDVKDRAVLTDFESILIEFHKLKPEYQEVIKEITEKMGNGMADYILDENYNLNGLQTVHDYDVYCHYVAGLVGDGLTRLIVIAKFANESLYSNEQLYESMGLFLQKTNIIRDYNEDLVDGRSFWPKEIWSQYAPQLKDFMKPENEQLGLDCINHLVLNALSHVIDVLTYLAGIHEQSTFQFCAIPQVMAIATLALVFNNREVLHGNVKIRKGTTCYLILKSRTLRGCVEIFDYYLRDIKSKLAVQDPNFLKLNIQISKIEQFMEEMYQDKLPPNVKPNETPIFLKVKERSRYDDELVPTQQEEEYKFNMVLSIILSVLLGFYYIYTLHRA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 102 | Acetylation | LLRHFHEKLLLTKWS HHHHHHHHHHCCCCC | 35.55 | 22865919 | |
| 107 | Ubiquitination | HEKLLLTKWSFDGNA HHHHHCCCCCCCCCC | 40.59 | 24961812 | |
| 107 | Acetylation | HEKLLLTKWSFDGNA HHHHHCCCCCCCCCC | 40.59 | 24489116 | |
| 118 | Acetylation | DGNAPDVKDRAVLTD CCCCCCHHCHHHHCC | 49.21 | 24489116 | |
| 145 | Acetylation | PEYQEVIKEITEKMG HHHHHHHHHHHHHHC | 48.52 | 24489116 | |
| 220 | Ubiquitination | SMGLFLQKTNIIRDY HHCHHHHHHCHHHCC | 45.76 | 17644757 | |
| 327 | Phosphorylation | NVKIRKGTTCYLILK CEEECCCCEEEEEEC | 19.41 | 27017623 | |
| 328 | Phosphorylation | VKIRKGTTCYLILKS EEECCCCEEEEEECC | 14.07 | 27017623 | |
| 330 | Phosphorylation | IRKGTTCYLILKSRT ECCCCEEEEEECCCC | 8.49 | 27017623 | |
| 335 | Phosphorylation | TCYLILKSRTLRGCV EEEEEECCCCHHHHH | 27.35 | 27017623 | |
| 337 | Phosphorylation | YLILKSRTLRGCVEI EEEECCCCHHHHHHH | 28.09 | 27017623 | |
| 355 | Ubiquitination | YLRDIKSKLAVQDPN HHHHHHHHHCCCCCC | 35.15 | 17644757 | |
| 365 | Ubiquitination | VQDPNFLKLNIQISK CCCCCCHHEEEEHHH | 35.04 | 17644757 | |
| 390 | Ubiquitination | DKLPPNVKPNETPIF CCCCCCCCCCCCCCE | 49.09 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FDFT_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FDFT_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FDFT_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
