| UniProt ID | MDM12_YEAST | |
|---|---|---|
| UniProt AC | Q92328 | |
| Protein Name | Mitochondrial distribution and morphology protein 12 {ECO:0000255|HAMAP-Rule:MF_03104} | |
| Gene Name | MDM12 {ECO:0000255|HAMAP-Rule:MF_03104} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 271 | |
| Subcellular Localization |
Mitochondrion outer membrane Peripheral membrane protein Cytoplasmic side . Endoplasmic reticulum membrane Peripheral membrane protein Cytoplasmic side . The ERMES/MDM complex localizes to a few discrete foci (around 10 per single cell), that |
|
| Protein Description | Component of the ERMES/MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria. [PubMed: 19556461 Components of this complex are involved in the control of mitochondrial shape and protein biogenesis, and function in nonvesicular lipid trafficking between the ER and mitochondria] | |
| Protein Sequence | MSFDINWSTLESDNRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAITLKEITDPLDEFYDSIREEADQETEENNDNKEDSEHICPDRTIANHEGPKDDFEAPVVMPSPNDIQFLLEVEYKGDLLVTIGADLVLNYPVEKFMTLPVKLSISDIGLHSLCIVACLSKQLFLSFLCDVSDPALDDNQTVLDPKGPILAATKPLERISIVRSMKIETEIGEQYQGQGSVLRSVGELEQFLFTIFKDFLRKELAWPSWINLDFNDGDE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 49 | Ubiquitination | VLDFDLGKVGPAITL EEECCCCCCCCCEEH | 51.84 | 23749301 | |
| 57 | Ubiquitination | VGPAITLKEITDPLD CCCCEEHHHCCCCHH | 38.12 | 17644757 | |
| 78 | Phosphorylation | REEADQETEENNDNK HHHHHHHCHHHCCCH | 42.86 | 28889911 | |
| 85 | Ubiquitination | TEENNDNKEDSEHIC CHHHCCCHHHHCCCC | 66.80 | 23749301 | |
| 88 | Phosphorylation | NNDNKEDSEHICPDR HCCCHHHHCCCCCCC | 31.97 | 28889911 | |
| 198 | Ubiquitination | NQTVLDPKGPILAAT CCCCCCCCCCCEEEC | 76.59 | 23749301 | |
| 206 | Ubiquitination | GPILAATKPLERISI CCCEEECCCHHHHEE | 42.76 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MDM12_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MDM12_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MDM12_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
