| UniProt ID | YPT11_YEAST | |
|---|---|---|
| UniProt AC | P48559 | |
| Protein Name | GTP-binding protein YPT11 | |
| Gene Name | YPT11 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 417 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Lipid-anchor Cytoplasmic side . Bud tip . Bud neck . Enriched in the peripheral ER of small buds and daughter cells. Concentrates at the site of bud emergence, at the bud tip of the growing bud, and at the bud neck |
|
| Protein Description | Involved in the positive control of both endoplasmic reticulum (ER) and mitochondrion inheritance during cell divison. Required for the MYO2-dependent retention of newly inherited mitochondria at the bud tip in developing daughter cells.. | |
| Protein Sequence | MSQRKRYSLNVVTSPSIPSPTPSAPIRTNESNWEAASPASAASSFLPNVHHGGTVLNPGLGIMRSPSLNKSGAFGRSGSSGSSTVIEPSNIKLLLIGDANVGKTAMILSYCRELLTRAEMSRSARLRHQQQQQHKDLGLKKTVVNHRLSMKEKRKRYSSNDFEKEFKDINHFADETSDFGNPNIGDDNNHEMADPNEIVIETRSTIGIDIKTNLVNIDNRFFNVILWDTAGQERYQNAIIPSLYKKTNAVILTYDITNAKSFQSCMERWIVQALENFSSQDLLKARFFLVGNKIDLYKERQVTHYDVVQMVQEMQLKHGIKISGNFEVSCKWVNVVERTMNMIILDLVENGCFENNDPCVSITTSDDVQGHEQEFHDTVEEPFNFTRQRQHQLEKNNTVDITKPNDDIANNQSICCV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Phosphorylation | VTSPSIPSPTPSAPI ECCCCCCCCCCCCCC | 39.47 | 28889911 | |
| 67 | Phosphorylation | LGIMRSPSLNKSGAF CCCCCCCCCCCCCCC | 45.91 | 21440633 | |
| 71 | Phosphorylation | RSPSLNKSGAFGRSG CCCCCCCCCCCCCCC | 33.99 | 21440633 | |
| 77 | Phosphorylation | KSGAFGRSGSSGSST CCCCCCCCCCCCCCC | 43.32 | 22369663 | |
| 79 | Phosphorylation | GAFGRSGSSGSSTVI CCCCCCCCCCCCCEE | 32.54 | 22369663 | |
| 80 | Phosphorylation | AFGRSGSSGSSTVIE CCCCCCCCCCCCEEC | 46.34 | 22369663 | |
| 82 | Phosphorylation | GRSGSSGSSTVIEPS CCCCCCCCCCEECCC | 25.45 | 22369663 | |
| 83 | Phosphorylation | RSGSSGSSTVIEPSN CCCCCCCCCEECCCC | 30.16 | 22369663 | |
| 84 | Phosphorylation | SGSSGSSTVIEPSNI CCCCCCCCEECCCCC | 27.48 | 22369663 | |
| 89 | Phosphorylation | SSTVIEPSNIKLLLI CCCEECCCCCEEEEE | 38.10 | 19823750 | |
| 149 | Phosphorylation | TVVNHRLSMKEKRKR HHHHHHCCHHHHHHH | 27.97 | 21440633 | |
| 158 | Phosphorylation | KEKRKRYSSNDFEKE HHHHHHHCCCHHHHH | 27.05 | 22369663 | |
| 159 | Phosphorylation | EKRKRYSSNDFEKEF HHHHHHCCCHHHHHH | 31.33 | 28889911 | |
| 415 | Geranylgeranylation | IANNQSICCV----- CCCCCCCEEC----- | 1.99 | - | |
| 416 | Geranylgeranylation | ANNQSICCV------ CCCCCCEEC------ | 3.76 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPT11_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPT11_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPT11_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-79 AND SER-158, AND MASSSPECTROMETRY. | |
