| UniProt ID | GTR2_YEAST | |
|---|---|---|
| UniProt AC | P53290 | |
| Protein Name | GTP-binding protein GTR2 | |
| Gene Name | GTR2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 341 | |
| Subcellular Localization | Vacuole membrane . | |
| Protein Description | GTPase. Component of the GSE complex, a GTPase complex required for intracellular sorting of GAP1 out of the endosome. Component of the EGO complex, a complex involved in the regulation of microautophagy.. | |
| Protein Sequence | MSLEATDSKAMVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAPVLRNSQKSSDKDNVINPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDIWANARASQAKNSIEDDV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 134 | Ubiquitination | DGLSEDFKVDAQRDI CCCCCCCCHHHHHHH | 52.07 | 24961812 | |
| 204 | Ubiquitination | IQHSKIEKAFLFDVN HHCCCCCEEEEEECC | 48.16 | 24961812 | |
| 253 | Phosphorylation | KAPVLRNSQKSSDKD CCHHCCCCCCCCCCC | 32.33 | 19823750 | |
| 259 | Ubiquitination | NSQKSSDKDNVINPR CCCCCCCCCCCCCCH | 53.82 | 23749301 | |
| 282 | Phosphorylation | LANGVIIYLRQMIRG HHHHHHHHHHHHHHH | 5.68 | 26447709 | |
| 331 | Phosphorylation | IWANARASQAKNSIE HHHHHHHHHHHHHCC | 25.72 | 21440633 | |
| 334 | Ubiquitination | NARASQAKNSIEDDV HHHHHHHHHHCCCCC | 43.52 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GTR2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GTR2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GTR2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
