dbPTM

FMP25_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FMP25_YEAST
UniProt AC	Q08023
Protein Name	Protein FMP25, mitochondrial
Gene Name	FMP25
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	583
Subcellular Localization	Mitochondrion membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MSFRLFTRTSQRLPRLNWVSPIRRYAKQPQYDEAELFAENINHGAYKAKKRPSDEHFQWPEKSPDQITKESELQWERMAKLSAVGQGILILVVVGGLGTAYLRWPELKSWWLIKMNGGRINATQEQSGQDSLEKLIRQKAKNLLREIPQVPAFQLGIDHPGVYIWGRCHSKDSLFPVRVPNLDGRKFRDILLAPSDDFNTNFAIDEKGDLISWDDLGQTKTILPDQDLTSMKYSSHFLYALNKKGEILVIPIRTPDLIASQVSSRRSKLLPWKTKLRYDWKLQTNQIFNGKEGEKRVVQFDAGSHHLVLLSNLGKAYCCATGNDQKQAQVSKGQFGIPTFSQFDEFPPNNQLFEIELLNKFKHEGEDVVRKREIKKIACGSYHTLAIDKTGEIYAFGWNRFGQLALPISYNLEYVSFPRSVTHAFKPHFPGMTNWKCVDIHCDDETSFVTIRKPGSTSDHHYFAFGNGLFGELGNNTFKNSQCDPIKIKSDDKKLTNWSCGSHCVFTETEQENEVIAWGNNDHGQLGIGKKTMKCAKPMNIPEVLKPGQDTTDLDSIYNSKLHLKKEQRVVTNGNKSCLYWRV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
556	Phosphorylation	QDTTDLDSIYNSKLH CCCCCHHHHHHCCCC	33.98	21440633

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FMP25_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FMP25_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FMP25_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SLU7_YEAST	SLU7	genetic	27708008
TAF6_YEAST	TAF6	genetic	27708008
RNA1_YEAST	RNA1	genetic	27708008
EI2BG_YEAST	GCD1	genetic	27708008
PEX5_YEAST	PEX5	genetic	27708008
QCR6_YEAST	QCR6	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FMP25_YEAST

Related Literatures of Post-Translational Modification