| UniProt ID | IPK1_YEAST | |
|---|---|---|
| UniProt AC | Q06667 | |
| Protein Name | Inositol-pentakisphosphate 2-kinase | |
| Gene Name | IPK1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 281 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Has kinase activity and phosphorylates inositol-1,3,4,5,6-pentakisphosphate (Ins(1,3,4,5,6)P5) to produce 1,2,3,4,5,6-hexakisphosphate (InsP6), also known as phytate.. | |
| Protein Sequence | MQVIGRGGANILIDYGDPTWLWRCCIRWPDLLSSNNSYTIKNISYIKDYVEPLLHGLLCPMYLIDVDIEAIRPILSDFILNLDDKVVKVIKIKNLTNNTSNLILNNHFLKSYCSQNLQTVILELKPKWLYYDTDYCRNCTHNAFKGRGTKYCYNQLLMNPAHLELIFGECNIFPVKFKDAMHEYLRNDNNIFKILYDLQKKLTKNTTPISDIKSINDVNDEHLLLMTLRDVTCFIEWNSAENALHVNIIDVDLKPKEKWTHWTKTYSQLTSSQKIYHTSNK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 111 | Phosphorylation | LNNHFLKSYCSQNLQ ECHHHHHHHHCCCCC | 33.25 | 26447709 | |
| 112 | Phosphorylation | NNHFLKSYCSQNLQT CHHHHHHHHCCCCCE | 8.43 | 26447709 | |
| 114 | Phosphorylation | HFLKSYCSQNLQTVI HHHHHHHCCCCCEEE | 17.55 | 26447709 | |
| 196 | Phosphorylation | NNIFKILYDLQKKLT CCHHHHHHHHHHHHC | 20.34 | 27017623 | |
| 263 | Phosphorylation | KEKWTHWTKTYSQLT HHHCCCHHHCHHHHH | 13.10 | 21440633 | |
| 265 | Phosphorylation | KWTHWTKTYSQLTSS HCCCHHHCHHHHHCC | 22.49 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IPK1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IPK1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IPK1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
