UniProt ID | COX5A_YEAST | |
---|---|---|
UniProt AC | P00424 | |
Protein Name | Cytochrome c oxidase polypeptide 5A, mitochondrial | |
Gene Name | COX5A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 153 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | ||
Protein Sequence | MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Acetylation | EQQDIVSKLSERQKL HHHHHHHHHHHHCCC | 45.17 | 24489116 | |
92 | Phosphorylation | PVLNKGDSSFIAKGV CCCCCCCHHHHHHHH | 35.50 | 27214570 | |
93 | Phosphorylation | VLNKGDSSFIAKGVA CCCCCCHHHHHHHHH | 25.97 | 27214570 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX5A_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX5A_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX5A_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
COX4_YEAST | COX4 | physical | 16554755 | |
YP216_YEAST | YPL216W | physical | 16554755 | |
MSS51_YEAST | MSS51 | genetic | 18541668 | |
COA2_YEAST | COA2 | genetic | 18541668 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...