| UniProt ID | COX5A_YEAST | |
|---|---|---|
| UniProt AC | P00424 | |
| Protein Name | Cytochrome c oxidase polypeptide 5A, mitochondrial | |
| Gene Name | COX5A | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 153 | |
| Subcellular Localization | Mitochondrion inner membrane. | |
| Protein Description | ||
| Protein Sequence | MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | Acetylation | EQQDIVSKLSERQKL HHHHHHHHHHHHCCC | 45.17 | 24489116 | |
| 92 | Phosphorylation | PVLNKGDSSFIAKGV CCCCCCCHHHHHHHH | 35.50 | 27214570 | |
| 93 | Phosphorylation | VLNKGDSSFIAKGVA CCCCCCHHHHHHHHH | 25.97 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX5A_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX5A_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX5A_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| COX4_YEAST | COX4 | physical | 16554755 | |
| YP216_YEAST | YPL216W | physical | 16554755 | |
| MSS51_YEAST | MSS51 | genetic | 18541668 | |
| COA2_YEAST | COA2 | genetic | 18541668 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...