| UniProt ID | COX4_YEAST | |
|---|---|---|
| UniProt AC | P04037 | |
| Protein Name | Cytochrome c oxidase subunit 4, mitochondrial | |
| Gene Name | COX4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 155 | |
| Subcellular Localization | Mitochondrion inner membrane. | |
| Protein Description | Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water.. | |
| Protein Sequence | MLSLRQSIRFFKPATRTLCSSRYLLQQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 32 | Acetylation | LQQKPVVKTAQNLAE HHCCCCCCCCCHHHH | 38.07 | 22865919 | |
| 55 | Phosphorylation | GPGAKEGTVPTDLDQ CCCCCCCCCCCCCCH | 25.14 | 28889911 | |
| 83 | Phosphorylation | EGIDVFDTKPLDSSR CCCEEECCCCCCCCC | 24.09 | 30377154 | |
| 84 | Acetylation | GIDVFDTKPLDSSRK CCEEECCCCCCCCCC | 45.48 | 24489116 | |
| 89 | Phosphorylation | DTKPLDSSRKGTMKD CCCCCCCCCCCCCCC | 37.36 | 30377154 | |
| 95 | Succinylation | SSRKGTMKDPIIIES CCCCCCCCCCEEEEE | 61.26 | 23954790 | |
| 125 | Acetylation | SHTIMWLKPTVNEVA CCEEEEECCCHHHHH | 24.11 | 24489116 | |
| 141 | Phosphorylation | CWECGSVYKLNPVGV HHCCCCEEEECCCCC | 16.08 | 25533186 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Profiling phosphoproteins of yeast mitochondria reveals a role ofphosphorylation in assembly of the ATP synthase."; Reinders J., Wagner K., Zahedi R.P., Stojanovski D., Eyrich B.,van der Laan M., Rehling P., Sickmann A., Pfanner N., Meisinger C.; Mol. Cell. Proteomics 6:1896-1906(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-55, AND MASSSPECTROMETRY. | |
