UniProt ID | COX4_YEAST | |
---|---|---|
UniProt AC | P04037 | |
Protein Name | Cytochrome c oxidase subunit 4, mitochondrial | |
Gene Name | COX4 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 155 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water.. | |
Protein Sequence | MLSLRQSIRFFKPATRTLCSSRYLLQQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Acetylation | LQQKPVVKTAQNLAE HHCCCCCCCCCHHHH | 38.07 | 22865919 | |
55 | Phosphorylation | GPGAKEGTVPTDLDQ CCCCCCCCCCCCCCH | 25.14 | 28889911 | |
83 | Phosphorylation | EGIDVFDTKPLDSSR CCCEEECCCCCCCCC | 24.09 | 30377154 | |
84 | Acetylation | GIDVFDTKPLDSSRK CCEEECCCCCCCCCC | 45.48 | 24489116 | |
89 | Phosphorylation | DTKPLDSSRKGTMKD CCCCCCCCCCCCCCC | 37.36 | 30377154 | |
95 | Succinylation | SSRKGTMKDPIIIES CCCCCCCCCCEEEEE | 61.26 | 23954790 | |
125 | Acetylation | SHTIMWLKPTVNEVA CCEEEEECCCHHHHH | 24.11 | 24489116 | |
141 | Phosphorylation | CWECGSVYKLNPVGV HHCCCCEEEECCCCC | 16.08 | 25533186 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX4_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Profiling phosphoproteins of yeast mitochondria reveals a role ofphosphorylation in assembly of the ATP synthase."; Reinders J., Wagner K., Zahedi R.P., Stojanovski D., Eyrich B.,van der Laan M., Rehling P., Sickmann A., Pfanner N., Meisinger C.; Mol. Cell. Proteomics 6:1896-1906(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-55, AND MASSSPECTROMETRY. |