UniProt ID | YD177_YEAST | |
---|---|---|
UniProt AC | Q12257 | |
Protein Name | IMPACT family member YDL177C | |
Gene Name | YDL177C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 170 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSKNVGKLVKIWNESEVLVDRKSKFQARCCPLQNQKDIPSILQELTQNNKSVSKASHMHMYAWRTAEVSNNLHLQQEQKKKGNKANKSNNSHVNKSRNITVQPKNIEQGCADCGEAGAGQRLLTLLERANIFNVLVIVTRWYGGTPLGSSRFRHISTCAVETLKKGGFLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YD177_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YD177_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD177_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD177_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GTR2_YEAST | GTR2 | genetic | 27708008 | |
ATG32_YEAST | ATG32 | genetic | 27708008 | |
RL8B_YEAST | RPL8B | genetic | 27708008 | |
RL21B_YEAST | RPL21B | genetic | 27708008 | |
NCBP2_YEAST | CBC2 | genetic | 27708008 | |
MDM10_YEAST | MDM10 | genetic | 27708008 | |
ECM15_YEAST | ECM15 | genetic | 27708008 | |
ARE1_YEAST | ARE1 | genetic | 27708008 | |
YGZ2_YEAST | YGL242C | genetic | 27708008 | |
RTG2_YEAST | RTG2 | genetic | 27708008 | |
STF2_YEAST | STF2 | genetic | 27708008 | |
RL26B_YEAST | RPL26B | genetic | 27708008 | |
ORM1_YEAST | ORM1 | genetic | 27708008 | |
SOL3_YEAST | SOL3 | genetic | 27708008 | |
ACA2_YEAST | CST6 | genetic | 27708008 | |
MET28_YEAST | MET28 | genetic | 27708008 | |
MOG1_YEAST | MOG1 | genetic | 27708008 | |
HOC1_YEAST | HOC1 | genetic | 27708008 | |
SIC1_YEAST | SIC1 | genetic | 27708008 | |
YL149_YEAST | YLR149C | genetic | 27708008 | |
MMS22_YEAST | MMS22 | genetic | 27708008 | |
FKS1_YEAST | FKS1 | genetic | 27708008 | |
GLRX8_YEAST | GRX8 | genetic | 27708008 | |
IMDH4_YEAST | IMD4 | genetic | 27708008 | |
TPS3_YEAST | TPS3 | genetic | 27708008 | |
APP1_YEAST | APP1 | genetic | 27708008 | |
YO268_YEAST | YOR268C | genetic | 27708008 | |
TGS1_YEAST | TGS1 | genetic | 27708008 | |
CHMU_YEAST | ARO7 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...