| UniProt ID | ECM15_YEAST | |
|---|---|---|
| UniProt AC | P35195 | |
| Protein Name | UPF0045 protein ECM15 | |
| Gene Name | ECM15 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 104 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | ||
| Protein Sequence | MPKIFCLADVCMVPIGTDSASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKISQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ECM15_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ECM15_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ECM15_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ECM15_YEAST | ECM15 | physical | 18719252 | |
| SAM37_YEAST | SAM37 | genetic | 14764870 | |
| SIA1_YEAST | SIA1 | genetic | 27708008 | |
| ETFD_YEAST | CIR2 | genetic | 27708008 | |
| CWC27_YEAST | CWC27 | genetic | 27708008 | |
| AIM4_YEAST | AIM4 | genetic | 27708008 | |
| SGF29_YEAST | SGF29 | genetic | 27708008 | |
| ELO2_YEAST | ELO2 | genetic | 27708008 | |
| AIM11_YEAST | AIM11 | genetic | 27708008 | |
| YIJ2_YEAST | YIL092W | genetic | 27708008 | |
| SDP1_YEAST | SDP1 | genetic | 27708008 | |
| BNR1_YEAST | BNR1 | genetic | 27708008 | |
| EIF3J_YEAST | HCR1 | genetic | 27708008 | |
| DDR48_YEAST | DDR48 | genetic | 27708008 | |
| CARME_YEAST | YNL092W | genetic | 27708008 | |
| INO4_YEAST | INO4 | genetic | 27708008 | |
| MDY2_YEAST | MDY2 | genetic | 27708008 | |
| YO012_YEAST | YOR012W | genetic | 27708008 | |
| SFM1_YEAST | SFM1 | genetic | 27708008 | |
| STE13_YEAST | STE13 | genetic | 27708008 | |
| PUS7_YEAST | PUS7 | genetic | 27708008 | |
| RDL1_YEAST | RDL1 | genetic | 27708008 | |
| NEW1_YEAST | NEW1 | genetic | 27708008 | |
| MDM36_YEAST | MDM36 | genetic | 27708008 | |
| ATG13_YEAST | ATG13 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...