UniProt ID | ECM15_YEAST | |
---|---|---|
UniProt AC | P35195 | |
Protein Name | UPF0045 protein ECM15 | |
Gene Name | ECM15 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 104 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MPKIFCLADVCMVPIGTDSASISDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVLKKISQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ECM15_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ECM15_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ECM15_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ECM15_YEAST | ECM15 | physical | 18719252 | |
SAM37_YEAST | SAM37 | genetic | 14764870 | |
SIA1_YEAST | SIA1 | genetic | 27708008 | |
ETFD_YEAST | CIR2 | genetic | 27708008 | |
CWC27_YEAST | CWC27 | genetic | 27708008 | |
AIM4_YEAST | AIM4 | genetic | 27708008 | |
SGF29_YEAST | SGF29 | genetic | 27708008 | |
ELO2_YEAST | ELO2 | genetic | 27708008 | |
AIM11_YEAST | AIM11 | genetic | 27708008 | |
YIJ2_YEAST | YIL092W | genetic | 27708008 | |
SDP1_YEAST | SDP1 | genetic | 27708008 | |
BNR1_YEAST | BNR1 | genetic | 27708008 | |
EIF3J_YEAST | HCR1 | genetic | 27708008 | |
DDR48_YEAST | DDR48 | genetic | 27708008 | |
CARME_YEAST | YNL092W | genetic | 27708008 | |
INO4_YEAST | INO4 | genetic | 27708008 | |
MDY2_YEAST | MDY2 | genetic | 27708008 | |
YO012_YEAST | YOR012W | genetic | 27708008 | |
SFM1_YEAST | SFM1 | genetic | 27708008 | |
STE13_YEAST | STE13 | genetic | 27708008 | |
PUS7_YEAST | PUS7 | genetic | 27708008 | |
RDL1_YEAST | RDL1 | genetic | 27708008 | |
NEW1_YEAST | NEW1 | genetic | 27708008 | |
MDM36_YEAST | MDM36 | genetic | 27708008 | |
ATG13_YEAST | ATG13 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...