| UniProt ID | MDY2_YEAST | |
|---|---|---|
| UniProt AC | Q12285 | |
| Protein Name | Ubiquitin-like protein MDY2 | |
| Gene Name | MDY2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 212 | |
| Subcellular Localization | Cytoplasm, cytosol. Nucleus. Detected in both cytosol and nucleus but is predominantly cytosolic. | |
| Protein Description | Required for efficient mating. Involved in the production of alpha-factor, the KAR9 and TUB1 location to the shmoo tip and nuclear migration into pheromone-induced shmoos.. | |
| Protein Sequence | MSTSASGPEHEFVSKFLTLATLTEPKLPKSYTKPLKDVTNLGVPLPTLKYKYKQNRAKKLKLHQDQQGQDNAAVHLTLKKIQAPKFSIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPNPTISKEPEAEKSTNSPAPAPPQELTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSTSASGPE ------CCCCCCCHH | 30.94 | 24909858 | |
| 3 | Phosphorylation | -----MSTSASGPEH -----CCCCCCCHHH | 27.32 | 28132839 | |
| 4 | Phosphorylation | ----MSTSASGPEHE ----CCCCCCCHHHH | 17.09 | 27717283 | |
| 6 | Phosphorylation | --MSTSASGPEHEFV --CCCCCCCHHHHHH | 55.43 | 30377154 | |
| 14 | Phosphorylation | GPEHEFVSKFLTLAT CHHHHHHHHHHHHHH | 24.02 | 30377154 | |
| 26 | Acetylation | LATLTEPKLPKSYTK HHHCCCCCCCCCCCC | 71.79 | 24489116 | |
| 33 | Acetylation | KLPKSYTKPLKDVTN CCCCCCCCCHHHCCC | 39.87 | 24489116 | |
| 49 | Acetylation | GVPLPTLKYKYKQNR CCCCCHHHHHHHHHH | 42.02 | 24489116 | |
| 85 | Acetylation | LKKIQAPKFSIEHDF EECCCCCCCEEECCC | 55.55 | 24489116 | |
| 118 | Acetylation | ASHISEIKLLLKGKV HHCHHHHHHHHCCCC | 29.09 | 22865919 | |
| 149 | Acetylation | STITVMIKPNPTISK CEEEEEECCCCCCCC | 22.20 | 24489116 | |
| 163 | Phosphorylation | KEPEAEKSTNSPAPA CCCCHHHCCCCCCCC | 25.07 | 22369663 | |
| 164 | Phosphorylation | EPEAEKSTNSPAPAP CCCHHHCCCCCCCCC | 51.27 | 22369663 | |
| 166 | Phosphorylation | EAEKSTNSPAPAPPQ CHHHCCCCCCCCCCC | 23.64 | 21440633 | |
| 176 | Phosphorylation | PAPPQELTVPWDDIE CCCCCCCCCCHHHHH | 24.62 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MDY2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MDY2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MDY2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
