| UniProt ID | GET4_YEAST | |
|---|---|---|
| UniProt AC | Q12125 | |
| Protein Name | Golgi to ER traffic protein 4 | |
| Gene Name | GET4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 312 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | May play a role in insertion of tail-anchored proteins into the endoplasmic reticulum membrane.. | |
| Protein Sequence | MVPAESNAVQAKLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGALSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMNNWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVDDIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFEDYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIVAPKQTNFLQDMMSGFLGGSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 47 | Ubiquitination | ANRYVRSKSYEHAIE HHHHHHCCCHHHHHH | 46.63 | 17644757 | |
| 48 | Phosphorylation | NRYVRSKSYEHAIEL HHHHHCCCHHHHHHH | 36.68 | 25005228 | |
| 49 | Phosphorylation | RYVRSKSYEHAIELI HHHHCCCHHHHHHHH | 18.57 | 25005228 | |
| 62 | Phosphorylation | LISQGALSFLKAKQG HHHHHHHHHHHHHCC | 28.18 | 25005228 | |
| 65 | Ubiquitination | QGALSFLKAKQGGSG HHHHHHHHHHCCCCH | 52.07 | 17644757 | |
| 130 | Acetylation | SIKFSEYKFGDPYLH EEEEEEEECCCCCCC | 38.53 | 24489116 | |
| 221 | Acetylation | FLERFIEKFHPKYEK HHHHHHHHHCCCCCC | 44.12 | 22865919 | |
| 260 | Acetylation | ITCQTKDKSYFLNLK HHCCCCCCCHHHHCC | 48.92 | 24489116 | |
| 260 | Succinylation | ITCQTKDKSYFLNLK HHCCCCCCCHHHHCC | 48.92 | 23954790 | |
| 279 | Phosphorylation | DFSQAYKSELEFLGQ CHHHHHHHHHHHHCH | 34.44 | 24909858 | |
| 288 | Phosphorylation | LEFLGQEYFNIVAPK HHHHCHHHHHEECCC | 8.27 | 24909858 | |
| 297 | Phosphorylation | NIVAPKQTNFLQDMM HEECCCCCCHHHHHH | 33.78 | 28889911 | |
| 305 | Phosphorylation | NFLQDMMSGFLGGSK CHHHHHHHHHCCCCC | 21.54 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GET4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GET4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GET4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
