| UniProt ID | ENT4_YEAST | |
|---|---|---|
| UniProt AC | Q07872 | |
| Protein Name | Epsin-4 | |
| Gene Name | ENT4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 247 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MPLLDTFKSFIQSPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQDPRDERKAEDIQKLSRNVLGLLQDDGLLEKQRKDVIQFRSSISTPGRKSTDNSHLKLEEMRSELTRQSLEKKAKPPTTSTSLDFQRQRTRNTHEYARFSLDPLAEEDSEDTPGVAGGISKLSFRPKSSNNPFR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 154 | Phosphorylation | KDVIQFRSSISTPGR HHHHHHHHHCCCCCC | 33.06 | 19823750 | |
| 155 | Phosphorylation | DVIQFRSSISTPGRK HHHHHHHHCCCCCCC | 19.12 | 23749301 | |
| 157 | Phosphorylation | IQFRSSISTPGRKST HHHHHHCCCCCCCCC | 30.42 | 24961812 | |
| 158 | Phosphorylation | QFRSSISTPGRKSTD HHHHHCCCCCCCCCC | 28.26 | 24961812 | |
| 163 | Phosphorylation | ISTPGRKSTDNSHLK CCCCCCCCCCCCCCC | 39.36 | 22369663 | |
| 164 | Phosphorylation | STPGRKSTDNSHLKL CCCCCCCCCCCCCCH | 42.08 | 22369663 | |
| 167 | Phosphorylation | GRKSTDNSHLKLEEM CCCCCCCCCCCHHHH | 32.76 | 19823750 | |
| 179 | Phosphorylation | EEMRSELTRQSLEKK HHHHHHHHHHHHHHH | 23.70 | 22369663 | |
| 182 | Phosphorylation | RSELTRQSLEKKAKP HHHHHHHHHHHHCCC | 34.89 | 22369663 | |
| 191 | Phosphorylation | EKKAKPPTTSTSLDF HHHCCCCCCCCHHHH | 41.74 | 22369663 | |
| 192 | Phosphorylation | KKAKPPTTSTSLDFQ HHCCCCCCCCHHHHH | 35.46 | 22369663 | |
| 193 | Phosphorylation | KAKPPTTSTSLDFQR HCCCCCCCCHHHHHH | 20.62 | 22369663 | |
| 194 | Phosphorylation | AKPPTTSTSLDFQRQ CCCCCCCCHHHHHHH | 31.08 | 22369663 | |
| 195 | Phosphorylation | KPPTTSTSLDFQRQR CCCCCCCHHHHHHHH | 26.21 | 22369663 | |
| 206 | Phosphorylation | QRQRTRNTHEYARFS HHHHCCCCHHHHHHC | 16.88 | 28889911 | |
| 213 | Phosphorylation | THEYARFSLDPLAEE CHHHHHHCCCCCCCC | 26.72 | 24909858 | |
| 222 | Phosphorylation | DPLAEEDSEDTPGVA CCCCCCCCCCCCCCC | 40.42 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ENT4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ENT4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ENT4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
