UniProt ID | FRMSR_YEAST | |
---|---|---|
UniProt AC | P36088 | |
Protein Name | Free methionine-R-sulfoxide reductase | |
Gene Name | YKL069W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 180 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Catalyzes the reversible oxidation-reduction of the R-enantiomer of free methionine sulfoxide to methionine. Does not act on S-enantiomer of free methionine sulfoxide or R-enantiomer of dabsylated methionine sulfoxide. Involved in protection against oxidative stress.. | |
Protein Sequence | MGSSTGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVFK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MGSSTGFHHA -----CCCCCCCCCC | 24.35 | 24961812 | |
4 | Phosphorylation | ----MGSSTGFHHAD ----CCCCCCCCCCC | 27.16 | 24961812 | |
5 | Phosphorylation | ---MGSSTGFHHADH ---CCCCCCCCCCCC | 45.63 | 24961812 | |
98 | Ubiquitination | CQMIQFGKGVCGTAA HEEEECCCCCCCCCC | 49.84 | 23749301 | |
118 | Acetylation | QIVPDVNKYPGHIAC EECCCHHHCCCCEEC | 53.31 | 24489116 | |
129 | Phosphorylation | HIACDGETKSEIVVP CEECCCCCCCEEEEE | 45.45 | 24930733 | |
175 | Ubiquitination | KLAKLINKSCVFK-- HHHHHHHHHCCCC-- | 37.93 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FRMSR_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FRMSR_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FRMSR_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...