| UniProt ID | DOG1_YEAST | |
|---|---|---|
| UniProt AC | P38774 | |
| Protein Name | 2-deoxyglucose-6-phosphate phosphatase 1 | |
| Gene Name | DOG1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 246 | |
| Subcellular Localization | ||
| Protein Description | Active on 2-DOG-6P, also very active on fructose-1P.. | |
| Protein Sequence | MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of DOG1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DOG1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DOG1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DOG1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BUD14_YEAST | BUD14 | genetic | 19269370 | |
| CAK1_YEAST | CAK1 | genetic | 19269370 | |
| PPME1_YEAST | PPE1 | genetic | 19269370 | |
| SUL1_YEAST | SUL1 | genetic | 20093466 | |
| AGP1_YEAST | AGP1 | genetic | 20093466 | |
| SGF29_YEAST | SGF29 | genetic | 20093466 | |
| SNT1_YEAST | SNT1 | genetic | 20093466 | |
| ARF1_YEAST | ARF1 | genetic | 20093466 | |
| HPRT_YEAST | HPT1 | genetic | 20093466 | |
| GEP7_YEAST | GEP7 | genetic | 20093466 | |
| SAC1_YEAST | SAC1 | genetic | 20093466 | |
| RAS2_YEAST | RAS2 | genetic | 20093466 | |
| VPH1_YEAST | VPH1 | genetic | 20093466 | |
| SIW14_YEAST | SIW14 | genetic | 27708008 | |
| SGF29_YEAST | SGF29 | genetic | 27708008 | |
| AGP1_YEAST | AGP1 | genetic | 27708008 | |
| SLX5_YEAST | SLX5 | genetic | 27708008 | |
| GEP7_YEAST | GEP7 | genetic | 27708008 | |
| VAM7_YEAST | VAM7 | genetic | 27708008 | |
| DAL81_YEAST | DAL81 | genetic | 27708008 | |
| FPS1_YEAST | FPS1 | genetic | 27708008 | |
| UBX2_YEAST | UBX2 | genetic | 27708008 | |
| RAS2_YEAST | RAS2 | genetic | 27708008 | |
| VPH1_YEAST | VPH1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...