UniProt ID | DOG1_YEAST | |
---|---|---|
UniProt AC | P38774 | |
Protein Name | 2-deoxyglucose-6-phosphate phosphatase 1 | |
Gene Name | DOG1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 246 | |
Subcellular Localization | ||
Protein Description | Active on 2-DOG-6P, also very active on fructose-1P.. | |
Protein Sequence | MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of DOG1_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DOG1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DOG1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DOG1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BUD14_YEAST | BUD14 | genetic | 19269370 | |
CAK1_YEAST | CAK1 | genetic | 19269370 | |
PPME1_YEAST | PPE1 | genetic | 19269370 | |
SUL1_YEAST | SUL1 | genetic | 20093466 | |
AGP1_YEAST | AGP1 | genetic | 20093466 | |
SGF29_YEAST | SGF29 | genetic | 20093466 | |
SNT1_YEAST | SNT1 | genetic | 20093466 | |
ARF1_YEAST | ARF1 | genetic | 20093466 | |
HPRT_YEAST | HPT1 | genetic | 20093466 | |
GEP7_YEAST | GEP7 | genetic | 20093466 | |
SAC1_YEAST | SAC1 | genetic | 20093466 | |
RAS2_YEAST | RAS2 | genetic | 20093466 | |
VPH1_YEAST | VPH1 | genetic | 20093466 | |
SIW14_YEAST | SIW14 | genetic | 27708008 | |
SGF29_YEAST | SGF29 | genetic | 27708008 | |
AGP1_YEAST | AGP1 | genetic | 27708008 | |
SLX5_YEAST | SLX5 | genetic | 27708008 | |
GEP7_YEAST | GEP7 | genetic | 27708008 | |
VAM7_YEAST | VAM7 | genetic | 27708008 | |
DAL81_YEAST | DAL81 | genetic | 27708008 | |
FPS1_YEAST | FPS1 | genetic | 27708008 | |
UBX2_YEAST | UBX2 | genetic | 27708008 | |
RAS2_YEAST | RAS2 | genetic | 27708008 | |
VPH1_YEAST | VPH1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...