UniProt ID | ARF1_YEAST | |
---|---|---|
UniProt AC | P11076 | |
Protein Name | ADP-ribosylation factor 1 | |
Gene Name | ARF1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 181 | |
Subcellular Localization | Golgi apparatus. | |
Protein Description | GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Recruits polyadenylate-binding protein PAB1 to COPI vesicles, and this is required for correct localization of the asymmetrically distributed ASH1 mRNA.. | |
Protein Sequence | MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKNST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | N-myristoyl glycine | ------MGLFASKLF ------CCHHHHHHH | 29.51 | - | |
2 | Myristoylation | ------MGLFASKLF ------CCHHHHHHH | 29.51 | 20601958 | |
10 | Phosphorylation | LFASKLFSNLFGNKE HHHHHHHHHHHCCCC | 42.96 | 21551504 | |
16 | Ubiquitination | FSNLFGNKEMRILMV HHHHHCCCCEEEEEE | 53.95 | 23749301 | |
16 | Acetylation | FSNLFGNKEMRILMV HHHHHCCCCEEEEEE | 53.95 | 24489116 | |
36 | Acetylation | GKTTVLYKLKLGEVI CCEEEEEEEECCCEE | 34.68 | 24489116 | |
127 | Ubiquitination | AWLVFANKQDLPEAM HHHEEECCCCHHHHH | 41.58 | 23749301 | |
135 | Phosphorylation | QDLPEAMSAAEITEK CCHHHHHCHHHHHHH | 31.23 | 25752575 | |
142 | Ubiquitination | SAAEITEKLGLHSIR CHHHHHHHHCCHHHC | 38.92 | 23749301 | |
142 | Acetylation | SAAEITEKLGLHSIR CHHHHHHHHCCHHHC | 38.92 | 24489116 | |
147 | Phosphorylation | TEKLGLHSIRNRPWF HHHHCCHHHCCCCEE | 28.43 | 22369663 | |
178 | Ubiquitination | EWLSNSLKNST---- HHHHHHHCCCC---- | 48.99 | 17644757 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...