| UniProt ID | ARF1_YEAST | |
|---|---|---|
| UniProt AC | P11076 | |
| Protein Name | ADP-ribosylation factor 1 | |
| Gene Name | ARF1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 181 | |
| Subcellular Localization | Golgi apparatus. | |
| Protein Description | GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Recruits polyadenylate-binding protein PAB1 to COPI vesicles, and this is required for correct localization of the asymmetrically distributed ASH1 mRNA.. | |
| Protein Sequence | MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKNST | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | N-myristoyl glycine | ------MGLFASKLF ------CCHHHHHHH | 29.51 | - | |
| 2 | Myristoylation | ------MGLFASKLF ------CCHHHHHHH | 29.51 | 20601958 | |
| 10 | Phosphorylation | LFASKLFSNLFGNKE HHHHHHHHHHHCCCC | 42.96 | 21551504 | |
| 16 | Ubiquitination | FSNLFGNKEMRILMV HHHHHCCCCEEEEEE | 53.95 | 23749301 | |
| 16 | Acetylation | FSNLFGNKEMRILMV HHHHHCCCCEEEEEE | 53.95 | 24489116 | |
| 36 | Acetylation | GKTTVLYKLKLGEVI CCEEEEEEEECCCEE | 34.68 | 24489116 | |
| 127 | Ubiquitination | AWLVFANKQDLPEAM HHHEEECCCCHHHHH | 41.58 | 23749301 | |
| 135 | Phosphorylation | QDLPEAMSAAEITEK CCHHHHHCHHHHHHH | 31.23 | 25752575 | |
| 142 | Ubiquitination | SAAEITEKLGLHSIR CHHHHHHHHCCHHHC | 38.92 | 23749301 | |
| 142 | Acetylation | SAAEITEKLGLHSIR CHHHHHHHHCCHHHC | 38.92 | 24489116 | |
| 147 | Phosphorylation | TEKLGLHSIRNRPWF HHHHCCHHHCCCCEE | 28.43 | 22369663 | |
| 178 | Ubiquitination | EWLSNSLKNST---- HHHHHHHCCCC---- | 48.99 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
