| UniProt ID | GET3_YEAST | |
|---|---|---|
| UniProt AC | Q12154 | |
| Protein Name | ATPase GET3 {ECO:0000255|HAMAP-Rule:MF_03112} | |
| Gene Name | GET3 {ECO:0000255|HAMAP-Rule:MF_03112} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 354 | |
| Subcellular Localization | Cytoplasm. Endoplasmic reticulum. Golgi apparatus. GET1 and GET2 are required for targeting GET3 to the endoplasmic reticulum. | |
| Protein Description | ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors GET1 and GET2, where the tail-anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the GET1-GET2 receptor, and returning it to the cytosol to initiate a new round of targeting. Cooperates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins that contain a C-terminal H-D-E-L retention signal from the Golgi to the ER. Involved in low-level resistance to the oxyanions arsenite and arsenate, and in heat tolerance.. | |
| Protein Sequence | MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | Acetylation | KWIFVGGKGGVGKTT EEEEECCCCCCCCCH | 46.71 | 24489116 | |
| 26 | 2-Hydroxyisobutyrylation | KWIFVGGKGGVGKTT EEEEECCCCCCCCCH | 46.71 | - | |
| 26 | Ubiquitination | KWIFVGGKGGVGKTT EEEEECCCCCCCCCH | 46.71 | 23749301 | |
| 69 | Acetylation | LSDAFGEKFGKDARK CHHHHHHHHCCHHHH | 60.85 | 24489116 | |
| 103 | Phosphorylation | DMNDMAVSRANNNGS HHHHHHHHHHCCCCC | 19.01 | 30377154 | |
| 150 | Ubiquitination | MEVMKHIKRQEQGEG HHHHHHHHHHHCCCC | 47.99 | 17644757 | |
| 185 | Ubiquitination | QLPNTLSKLLEKFGE HCCHHHHHHHHHHHH | 61.27 | 17644757 | |
| 185 | Acetylation | QLPNTLSKLLEKFGE HCCHHHHHHHHHHHH | 61.27 | 24489116 | |
| 189 | Acetylation | TLSKLLEKFGEITNK HHHHHHHHHHHHHHH | 59.65 | 24489116 | |
| 189 | Ubiquitination | TLSKLLEKFGEITNK HHHHHHHHHHHHHHH | 59.65 | 24961812 | |
| 196 | Ubiquitination | KFGEITNKLGPMLNS HHHHHHHHHHHHHHH | 46.28 | 24961812 | |
| 203 | Phosphorylation | KLGPMLNSFMGAGNV HHHHHHHHHCCCCCC | 16.79 | 30377154 | |
| 297 | Ubiquitination | ARWKMQKKYLDQIDE HHHHHHHHHHHHHHH | 33.87 | 23749301 | |
| 297 | Acetylation | ARWKMQKKYLDQIDE HHHHHHHHHHHHHHH | 33.87 | 24489116 | |
| 313 | Ubiquitination | YEDFHVVKMPLCAGE HHHCCEEECCCCHHH | 33.44 | 23749301 | |
| 328 | Phosphorylation | IRGLNNLTKFSQFLN HCCHHHHHHHHHHHC | 31.97 | 19823750 | |
| 329 | Ubiquitination | RGLNNLTKFSQFLNK CCHHHHHHHHHHHCC | 46.30 | 23749301 | |
| 329 | Acetylation | RGLNNLTKFSQFLNK CCHHHHHHHHHHHCC | 46.30 | 24489116 | |
| 336 | Acetylation | KFSQFLNKEYNPITD HHHHHHCCCCCCCCC | 64.82 | 24489116 | |
| 345 | Acetylation | YNPITDGKVIYELED CCCCCCCEEEEEECC | 28.41 | 24489116 | |
| 353 | Ubiquitination | VIYELEDKE------ EEEEECCCC------ | 56.82 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GET3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GET3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GET3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
