| UniProt ID | ICP55_YEAST | |
|---|---|---|
| UniProt AC | P40051 | |
| Protein Name | Intermediate cleaving peptidase 55 | |
| Gene Name | ICP55 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 511 | |
| Subcellular Localization |
Nucleus. Mitochondrion inner membrane Peripheral membrane protein Matrix side. Has the same dual localization (mitochondrion and nucleus) as one of its substrate, NFS1. |
|
| Protein Description | Aminopeptidase which cleaves preprotein intermediates that carry destabilizing N-ter amino acid residues after the mitochondrial processing peptidase (MPP) cleavage site and is thus critical for stabilization of the mitochondrial proteome.. | |
| Protein Sequence | MLHRINPVRFSMQSCQRYFSKLVSPLEQHKSNTFTNRVRIPIEAGQPLHETRPFLIKSGELTPGISALEYYERRIRLAETLPPKSCVILAGNDIQFASGAVFYPFQQENDLFYLSGWNEPNSVMILEKPTDSLSDTIFHMLVPPKDAFAEKWEGFRSGVYGVQEIFNADESASINDLSKYLPKIINRNDFIYFDMLSTSNPSSSNFKHIKSLLDGSGNSNRSLNSIANKTIKPISKRIAEFRKIKSPQELRIMRRAGQISGRSFNQAFAKRFRNERTLDSFLHYKFISGGCDKDAYIPVVATGSNSLCIHYTRNDDVMFDDEMVLVDAAGSLGGYCADISRTWPNSGKFTDAQRDLYEAVLNVQRDCIKLCKASNNYSLHDIHEKSITLMKQELKNLGIDKVSGWNVEKLYPHYIGHNLGLDVHDVPKVSRYEPLKVGQVITIEPGLYIPNEESFPSYFRNVGIRIEDDIAIGEDTYTNLTVEAVKEIDDLENVMQNGLSTKFEEDQVAPL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 183 | Acetylation | DLSKYLPKIINRNDF HHHHHHHHHHCCCCE | 54.33 | 24489116 | |
| 207 | Acetylation | NPSSSNFKHIKSLLD CCCCCCHHHHHHHHC | 48.98 | 24489116 | |
| 211 | Phosphorylation | SNFKHIKSLLDGSGN CCHHHHHHHHCCCCC | 33.30 | 22369663 | |
| 216 | Phosphorylation | IKSLLDGSGNSNRSL HHHHHCCCCCCCHHH | 34.17 | 22369663 | |
| 219 | Phosphorylation | LLDGSGNSNRSLNSI HHCCCCCCCHHHHHH | 36.83 | 22369663 | |
| 385 | Acetylation | SLHDIHEKSITLMKQ CHHHHHHHHHHHHHH | 32.75 | 24489116 | |
| 391 | Acetylation | EKSITLMKQELKNLG HHHHHHHHHHHHHCC | 43.67 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ICP55_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ICP55_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ICP55_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
