dbPTM

YP071_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YP071_YEAST
UniProt AC	Q02864
Protein Name	Uncharacterized protein YPL071C
Gene Name	YPL071C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	156
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description
Protein Sequence	MSSRFARSNGNPNHIRKRNHSPDPIGIDNYKRKRLIIDLENLSLNDKGPKNGHADDNNLIHNNIVFTDAIDDKVLKEIIKCSTSKRGDNDLFYDKIWERLREKRLQIIKWVDYKEIAYLSWWKWFHNQMTSKYTYDGEADTDVEMMAVDTDVDMDA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
21	Phosphorylation	HIRKRNHSPDPIGID CHHHCCCCCCCCCCC	34.25	22369663
30	Phosphorylation	DPIGIDNYKRKRLII CCCCCCCCCCCEEEE	14.39	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YP071_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YP071_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YP071_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ASK10_YEAST	ASK10	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
EIF3J_YEAST	HCR1	genetic	27708008
GBLP_YEAST	ASC1	genetic	27708008
FAR7_YEAST	FAR7	genetic	27708008
GOSR1_YEAST	GOS1	genetic	27708008
AGE2_YEAST	AGE2	genetic	27708008
SYS1_YEAST	SYS1	genetic	27708008
VPS53_YEAST	VPS53	genetic	27708008
RSSA2_YEAST	RPS0B	genetic	27708008
SIC1_YEAST	SIC1	genetic	27708008
ADE_YEAST	AAH1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YP071_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21, AND MASSSPECTROMETRY.	18407956 [Abstract]
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21, AND MASSSPECTROMETRY.	17563356 [Abstract]
"Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21, AND MASSSPECTROMETRY.	17287358 [Abstract]