| UniProt ID | GOSR1_YEAST | |
|---|---|---|
| UniProt AC | P38736 | |
| Protein Name | Golgi SNAP receptor complex member 1 | |
| Gene Name | GOS1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 223 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type IV membrane protein . Punctate localization pattern. Localization affected by loss of SVP26, a membrane protein, and is shifted to the ER. |
|
| Protein Description | Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor. Rescues alpha-factor maturation defects.. | |
| Protein Sequence | MSSQPSFVTIRGKAISLETQTESLLSKYSTFAQTTSSEQTGQEKKIDKQLEGILGQRQDVIDSLTQICDSNPAISASKLSQLHRHKEILQDHWKSFRNIRSSIQQERNRLNLLFSVKNDIANSTTDAPAPIGDADEYIQNETRRIDQSNNVVDRLISQAWETRSQFHSQSNVLNTANNKVLQTLQRIPGVNQLIMKINTRRKKNAFVLATITTLCILFLFFTW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSSQPSFVT ------CCCCCCEEE | 37.37 | 22814378 | |
| 45 | Acetylation | EQTGQEKKIDKQLEG HHHCCHHHHHHHHHH | 56.22 | 24489116 | |
| 48 | Acetylation | GQEKKIDKQLEGILG CCHHHHHHHHHHHHC | 61.32 | 24489116 | |
| 78 | Ubiquitination | NPAISASKLSQLHRH CCCCCHHHHHHHHHH | 52.45 | 17644757 | |
| 86 | Ubiquitination | LSQLHRHKEILQDHW HHHHHHHHHHHHHHH | 46.54 | 17644757 | |
| 94 | Ubiquitination | EILQDHWKSFRNIRS HHHHHHHHHHHHHHH | 35.98 | 17644757 | |
| 117 | Ubiquitination | LNLLFSVKNDIANST HHHHHHHHHHHCCCC | 47.94 | 17644757 | |
| 123 | Phosphorylation | VKNDIANSTTDAPAP HHHHHCCCCCCCCCC | 24.54 | 23749301 | |
| 164 | Phosphorylation | SQAWETRSQFHSQSN HHHHHHHHHHHCCCH | 44.62 | 17330950 | |
| 168 | Phosphorylation | ETRSQFHSQSNVLNT HHHHHHHCCCHHHHH | 36.27 | 28889911 | |
| 170 | Phosphorylation | RSQFHSQSNVLNTAN HHHHHCCCHHHHHHC | 31.74 | 19779198 | |
| 179 | Ubiquitination | VLNTANNKVLQTLQR HHHHHCHHHHHHHHC | 44.10 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GOSR1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GOSR1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GOSR1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-164, AND MASSSPECTROMETRY. | |
