| UniProt ID | ORM2_YEAST | |
|---|---|---|
| UniProt AC | Q06144 | |
| Protein Name | Protein ORM2 | |
| Gene Name | ORM2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 216 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Component of the SPOTS complex that acts as a negative regulator of sphingolipid synthesis. Acts by inhibiting serine palmitoyltransferases (LCB1 and LCB2) activity.. | |
| Protein Sequence | MIDRTKNESPAFEESPLTPNVSNLKPFPSQSNKISTPVTDHRRRRSSSVISHVEQETFEDENDQQMLPNMNATWVDQRGAWLIHIVVIVLLRLFYSLFGSTPKWTWTLTNMTYIIGFYIMFHLVKGTPFDFNGGAYDNLTMWEQINDETLYTPTRKFLLIVPIVLFLISNQYYRNDMTLFLSNLAVTVLIGVVPKLGITHRLRISIPGITGRAQIS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MIDRTKNESPAF ---CCCCCCCCCCCC | 34.18 | 29136822 | |
| 6 | Ubiquitination | --MIDRTKNESPAFE --CCCCCCCCCCCCC | 60.66 | 17644757 | |
| 9 | Phosphorylation | IDRTKNESPAFEESP CCCCCCCCCCCCCCC | 30.81 | 22369663 | |
| 15 | Phosphorylation | ESPAFEESPLTPNVS CCCCCCCCCCCCCCC | 20.29 | 22369663 | |
| 18 | Phosphorylation | AFEESPLTPNVSNLK CCCCCCCCCCCCCCC | 19.05 | 22369663 | |
| 22 | Phosphorylation | SPLTPNVSNLKPFPS CCCCCCCCCCCCCCC | 42.98 | 22369663 | |
| 25 | Acetylation | TPNVSNLKPFPSQSN CCCCCCCCCCCCCCC | 49.19 | 24489116 | |
| 25 | Ubiquitination | TPNVSNLKPFPSQSN CCCCCCCCCCCCCCC | 49.19 | 17644757 | |
| 29 | Phosphorylation | SNLKPFPSQSNKIST CCCCCCCCCCCCCCC | 46.77 | 22369663 | |
| 31 | Phosphorylation | LKPFPSQSNKISTPV CCCCCCCCCCCCCCC | 44.41 | 22369663 | |
| 33 | Ubiquitination | PFPSQSNKISTPVTD CCCCCCCCCCCCCCC | 43.19 | 24961812 | |
| 35 | Phosphorylation | PSQSNKISTPVTDHR CCCCCCCCCCCCCHH | 28.41 | 28889911 | |
| 36 | Phosphorylation | SQSNKISTPVTDHRR CCCCCCCCCCCCHHH | 25.83 | 29136822 | |
| 51 | Phosphorylation | RRSSSVISHVEQETF HHCCHHHHHHHHHHC | 21.23 | 19779198 | |
| 57 | Phosphorylation | ISHVEQETFEDENDQ HHHHHHHHCCCCCHH | 31.83 | 19779198 | |
| 95 | Phosphorylation | IVLLRLFYSLFGSTP HHHHHHHHHHHCCCC | 14.73 | 27017623 | |
| 96 | Phosphorylation | VLLRLFYSLFGSTPK HHHHHHHHHHCCCCC | 15.19 | 27017623 | |
| 136 | Phosphorylation | FDFNGGAYDNLTMWE CCCCCCCCCCCEEEH | 14.51 | 27017623 | |
| 152 | Phosphorylation | INDETLYTPTRKFLL CCCCCCCCCCHHHHH | 22.69 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ORM2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ORM2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ORM2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-9, AND MASSSPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-9 AND SER-15, AND MASSSPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-18, AND MASSSPECTROMETRY. | |