UniProt ID | OCA2_YEAST | |
---|---|---|
UniProt AC | P53949 | |
Protein Name | Tyrosine-protein phosphatase-like protein OCA2 | |
Gene Name | OCA2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 197 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Required for normal growth in the presence of linoleic acid hydroperoxide (LoaOOH).. | |
Protein Sequence | MKYIPPLNFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYIGDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGICQEYGLFSGGMKDGVDLEFITMFETNLKIPRNVIPGFAKHCLYLNELEAAEGSDDESGSESILTAKQPI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MKYIPPLNFS -----CCCCCCCCCC | 19.84 | 28132839 | |
181 | Phosphorylation | ELEAAEGSDDESGSE HHHHHCCCCCCCCCC | 33.13 | 17330950 | |
185 | Phosphorylation | AEGSDDESGSESILT HCCCCCCCCCCCCCE | 55.39 | 17330950 | |
187 | Phosphorylation | GSDDESGSESILTAK CCCCCCCCCCCCEEC | 37.13 | 28889911 | |
189 | Phosphorylation | DDESGSESILTAKQP CCCCCCCCCCEECCC | 25.29 | 19795423 | |
192 | Phosphorylation | SGSESILTAKQPI-- CCCCCCCEECCCC-- | 30.09 | 19795423 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OCA2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OCA2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OCA2_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-181, AND MASSSPECTROMETRY. | |
"Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-181, AND MASSSPECTROMETRY. |