UniProt ID | AIM26_YEAST | |
---|---|---|
UniProt AC | P32858 | |
Protein Name | Altered inheritance of mitochondria protein 26, mitochondrial | |
Gene Name | AIM26 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 118 | |
Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein . |
|
Protein Description | Involved in selective mitochondria autophagy (mitophagy).. | |
Protein Sequence | MQTMGGEHLLLSQLKGSFFLLLLAYFFRGRSPYYARCYRRLAVTPGAITIAIAIATDSIPALAKSKVLVSVCSHTDPCTASCNLIPFPRPFSNSLTRFLFCLGSARFCISFPCFGLSI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
104 | Phosphorylation | RFLFCLGSARFCISF HHHHHHHCCCEEEEE | 11.88 | 25882841 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AIM26_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIM26_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIM26_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SLT2_YEAST | SLT2 | genetic | 14764870 | |
BCK1_YEAST | BCK1 | genetic | 14764870 | |
PP2C1_YEAST | PTC1 | genetic | 14764870 | |
UBP3_YEAST | UBP3 | genetic | 14764870 | |
FPS1_YEAST | FPS1 | genetic | 14764870 | |
ABF2_YEAST | ABF2 | genetic | 14764870 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...