AIM26_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AIM26_YEAST
• UniProt AC: P32858
• Protein Name: Altered inheritance of mitochondria protein 26, mitochondrial
• Gene Name: AIM26
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 118
• Subcellular Localization: Mitochondrion membrane ; Multi-pass membrane protein .
• Protein Description: Involved in selective mitochondria autophagy (mitophagy)..
• Protein Sequence: MQTMGGEHLLLSQLKGSFFLLLLAYFFRGRSPYYARCYRRLAVTPGAITIAIAIATDSIPALAKSKVLVSVCSHTDPCTASCNLIPFPRPFSNSLTRFLFCLGSARFCISFPCFGLSI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
104	Phosphorylation	RFLFCLGSARFCISF HHHHHHHCCCEEEEE	11.88	25882841

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AIM26_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AIM26_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AIM26_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SLT2_YEAST	SLT2	genetic	14764870
BCK1_YEAST	BCK1	genetic	14764870
PP2C1_YEAST	PTC1	genetic	14764870
UBP3_YEAST	UBP3	genetic	14764870
FPS1_YEAST	FPS1	genetic	14764870
ABF2_YEAST	ABF2	genetic	14764870

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.