| UniProt ID | ABF2_YEAST | |
|---|---|---|
| UniProt AC | Q02486 | |
| Protein Name | ARS-binding factor 2, mitochondrial | |
| Gene Name | ABF2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 183 | |
| Subcellular Localization | Mitochondrion. Nucleus . | |
| Protein Description | Specific binding to the autonomously replicating sequence 1 (ARS1). Interaction with regulatory regions: probably involved in compacting the mitochondrial genome. It might play a positive role in gene expression and replication.. | |
| Protein Sequence | MNSYSLLTRSFHESSKPLFNLASTLLKASKRTQLRNELIKQGPKRPTSAYFLYLQDHRSQFVKENPTLRPAEISKIAGEKWQNLEADIKEKYISERKKLYSEYQKAKKEFDEKLPPKKPAGPFIKYANEVRSQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQEYNARYPLN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 47 | Phosphorylation | KQGPKRPTSAYFLYL HHCCCCCCCHHEEEH | 29.98 | 30377154 | |
| 48 | Phosphorylation | QGPKRPTSAYFLYLQ HCCCCCCCHHEEEHH | 24.53 | 30377154 | |
| 59 | Phosphorylation | LYLQDHRSQFVKENP EEHHHHHHHHHHHCC | 25.26 | 24961812 | |
| 63 | Acetylation | DHRSQFVKENPTLRP HHHHHHHHHCCCCCH | 53.73 | 24489116 | |
| 74 | Phosphorylation | TLRPAEISKIAGEKW CCCHHHHHHHHCHHH | 14.98 | 28889911 | |
| 75 | Acetylation | LRPAEISKIAGEKWQ CCHHHHHHHHCHHHH | 42.09 | 24489116 | |
| 80 | Acetylation | ISKIAGEKWQNLEAD HHHHHCHHHHCCCHH | 53.84 | 24489116 | |
| 89 | Acetylation | QNLEADIKEKYISER HCCCHHHHHHHHHHH | 49.02 | 24489116 | |
| 91 | Acetylation | LEADIKEKYISERKK CCHHHHHHHHHHHHH | 42.77 | 24489116 | |
| 100 | Phosphorylation | ISERKKLYSEYQKAK HHHHHHHHHHHHHHH | 14.34 | 22369663 | |
| 101 | Phosphorylation | SERKKLYSEYQKAKK HHHHHHHHHHHHHHH | 40.02 | 22369663 | |
| 103 | Phosphorylation | RKKLYSEYQKAKKEF HHHHHHHHHHHHHHH | 14.90 | 22369663 | |
| 105 | Acetylation | KLYSEYQKAKKEFDE HHHHHHHHHHHHHHH | 62.36 | 25381059 | |
| 125 | Acetylation | KPAGPFIKYANEVRS CCCCHHHHHHHHHHH | 38.39 | 24489116 | |
| 132 | Phosphorylation | KYANEVRSQVFAQHP HHHHHHHHHHHHHCC | 35.55 | 21440633 | |
| 141 | Acetylation | VFAQHPDKSQLDLMK HHHHCCCHHHHHHHH | 44.55 | 24489116 | |
| 142 | Phosphorylation | FAQHPDKSQLDLMKI HHHCCCHHHHHHHHH | 43.27 | 30377154 | |
| 148 | Acetylation | KSQLDLMKIIGDKWQ HHHHHHHHHHHHHHH | 38.17 | 24489116 | |
| 153 | Acetylation | LMKIIGDKWQSLDQS HHHHHHHHHHHHCHH | 41.75 | 24489116 | |
| 162 | 2-Hydroxyisobutyrylation | QSLDQSIKDKYIQEY HHHCHHHHHHHHHHH | 54.11 | - | |
| 162 | Succinylation | QSLDQSIKDKYIQEY HHHCHHHHHHHHHHH | 54.11 | 23954790 | |
| 164 | Acetylation | LDQSIKDKYIQEYKK HCHHHHHHHHHHHHH | 38.97 | 24489116 | |
| 170 | Acetylation | DKYIQEYKKAIQEYN HHHHHHHHHHHHHHH | 34.67 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ABF2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ABF2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ABF2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
