| UniProt ID | RRG1_YEAST | |
|---|---|---|
| UniProt AC | Q12167 | |
| Protein Name | Required for respiratory growth protein 1, mitochondrial | |
| Gene Name | RRG1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 365 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Essential for respiratory growth and required for mitochondrial protein synthesis. Required for vacuolar acidification.. | |
| Protein Sequence | MAQNFGKIPSHKSYVLSLYRTVLRNIPKCCHSYAFQYEIKKTLSIQLFKHKHDKSSWSVYTLLNEFSLLNNCLLEGKLQEIKNLMKPLKKMKKQLKTTKILNSLTSLGDVKTNDPEEVRRFHVLSAYIKRKQDLGLLPAYIPKTYQHKLLLPLALNEHACLKLFHIQQKLKNGPPSAGLSYTKEGRNQIWFVRSPINKGRQQSKKLGILIRKERKDSQKNIDNLNFCEINAAWALHEAIWEEYLESKKIIKVNLPKYLEYAANIPKSTKCNPSSQYQKVKEWVDPVREIMFELHSKSFQRVEYFNKYKEKLLKNGGQLAYFDKKSKEMYAKRLTLFRKMSKETLPYVTLFIEGRDLPSVLAKYGF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | QNFGKIPSHKSYVLS CCCCCCCCCHHHHHH | 47.20 | 30377154 | |
| 13 | Phosphorylation | GKIPSHKSYVLSLYR CCCCCCHHHHHHHHH | 18.30 | 30377154 | |
| 14 | Phosphorylation | KIPSHKSYVLSLYRT CCCCCHHHHHHHHHH | 15.37 | 30377154 | |
| 17 | Phosphorylation | SHKSYVLSLYRTVLR CCHHHHHHHHHHHHH | 17.20 | 30377154 | |
| 19 | Phosphorylation | KSYVLSLYRTVLRNI HHHHHHHHHHHHHCC | 10.81 | 30377154 | |
| 340 | Phosphorylation | LTLFRKMSKETLPYV HHHHHHHCCCCCCEE | 30.30 | 27017623 | |
| 358 | Phosphorylation | IEGRDLPSVLAKYGF EECCCHHHHHHHHCC | 36.74 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRG1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRG1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRG1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...