| UniProt ID | TIM22_YEAST | |
|---|---|---|
| UniProt AC | Q12328 | |
| Protein Name | Mitochondrial import inner membrane translocase subunit TIM22 | |
| Gene Name | TIM22 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 207 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . Import into inner membrane protein requires TOM20 function. |
|
| Protein Description | Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins, such as mitochondrial carrier family members, into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps. Mediates the insertion of precursor proteins in a 3 step process. After the precursor is tethered to the translocase without losing energy from the Delta(psi), 2 energy-requiring steps are needed. First, Delta(psi) acts on the precursor protein and promotes its docking in the translocase complex. Then, Delta(psi) and an internal signal peptide together induce rapid gating transitions in one pore and closing of the other pore and drive membrane insertion to completion.. | |
| Protein Sequence | MVYTGFGLEQISPAQKKPYNELTPEEQGERGAEMIMNFMTSCPGKSVVSGVTGFALGGVLGLFMASMAYDTPLHTPTPANTAATATAGNIGVGGISRTVQQISDLPFRQQMKLQFTDMGKKSYSSAKNFGYIGMIYAGVECVIESLRAKNDIYNGVTAGFFTGAGLAYKAGPQAALMGGAGFAAFSAAIDLYMKSEDGRPPQNDFKE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MVYTGFGLEQ -----CCCCCCCHHH | 10.39 | 28132839 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM22_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM22_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM22_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...