YO024_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YO024_YEAST
• UniProt AC: Q08172
• Protein Name: Putative uncharacterized protein YOL024W
• Gene Name: YOL024W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 172
• Protein Sequence: MSKLSSYPHAADFINMEEPPKSKEFFDDLCAVPNLLKRRFPNSRRSTHYCEALNYSRKKLPVVLSKMTLQELRHNMSTFFLQEKDQINIYDTCKVIDMGDRVLLETMPPQPRDLFEKLHASKTNLVVQTAALDEPLLTVKAELQSSSFPQKSSLFLYEDYKKFIYQQLDMFS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YO024_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YO024_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YO024_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YO024_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YCY0_YEAST	YCR090C	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
YL287_YEAST	YLR287C	genetic	27708008
BUD31_YEAST	BUD31	genetic	27708008
HXKB_YEAST	HXK2	genetic	27708008
PFD3_YEAST	PAC10	genetic	27708008
RL14A_YEAST	RPL14A	genetic	27708008
ELM1_YEAST	ELM1	genetic	27708008
ROM2_YEAST	ROM2	genetic	27708008
CORO_YEAST	CRN1	genetic	27708008
HSP7F_YEAST	SSE1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.