| UniProt ID | YL287_YEAST | |
|---|---|---|
| UniProt AC | Q05881 | |
| Protein Name | Uncharacterized protein YLR287C | |
| Gene Name | YLR287C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 355 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | ||
| Protein Sequence | MSTGSSDRKDDVKLLELLNSIDEQFLVPYKKPEDLRKISSTTKLQGSTPTKELDKLASVLKAHCTKIGIVCKPGTFDNNHKVVITEIQNFSRPLFYLLSLFPLFYNNKDCPKYFTDQLDESTLQLLDGLRDFIAELQERLKNDENASLDKERLTSVGKIFNACDSLSNCSKAGPYGILANILKDNVAIMDDTMNEIKEWLEEPDFSANSDDIFLDFEDSESESDSQKEEFDQEKVYENIKLFFDGFTRKIKLIKLLVSTFRKTLVSKDFTPKRNQAETLDSIHTYLKEIQLLLDEVVSTVQFEPKNFTNEEVKEEQAALVAVTKKVLIQMSKLYEGDPKRKKWIDTWEIKFNELF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 51 | Acetylation | LQGSTPTKELDKLAS CCCCCCHHHHHHHHH | 58.44 | 24489116 | |
| 55 | Acetylation | TPTKELDKLASVLKA CCHHHHHHHHHHHHH | 59.59 | 24489116 | |
| 234 | Acetylation | KEEFDQEKVYENIKL HHHHHHHHHHHHHHH | 44.47 | 22865919 | |
| 313 | Acetylation | NFTNEEVKEEQAALV CCCCHHHHHHHHHHH | 59.83 | 24489116 | |
| 342 | Acetylation | EGDPKRKKWIDTWEI CCCCCCCCCEEEEEC | 54.11 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL287_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL287_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL287_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| USA1_YEAST | USA1 | physical | 16554755 | |
| MRP8_YEAST | MRP8 | physical | 16429126 | |
| RLA3_YEAST | RPP1B | physical | 11283351 | |
| EIF3G_YEAST | TIF35 | genetic | 19061648 | |
| RSA3_YEAST | RSA3 | genetic | 19061648 | |
| LSM7_YEAST | LSM7 | genetic | 19061648 | |
| NCBP2_YEAST | CBC2 | genetic | 19061648 | |
| GPR1_YEAST | GPR1 | genetic | 27708008 | |
| RV167_YEAST | RVS167 | genetic | 27708008 | |
| MAC1_YEAST | MAC1 | genetic | 27708008 | |
| PKR1_YEAST | PKR1 | genetic | 27708008 | |
| NCBP2_YEAST | CBC2 | genetic | 27708008 | |
| LCB2_YEAST | LCB2 | genetic | 29674565 | |
| STN1_YEAST | STN1 | genetic | 29674565 | |
| ATP18_YEAST | ATP18 | genetic | 29674565 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...