HOR7_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HOR7_YEAST
• UniProt AC: Q05827
• Protein Name: Protein HOR7
• Gene Name: HOR7
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 59
• Protein Sequence: MKLSQVVVSAVAFTGLVSAANSSNSSSSKNAAQPIAGLNNGKVAGAAGVALAGALAFLI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	VVSAVAFTGLVSAAN HHHHHHHHHHHHHHC	21.62	19779198
18	Phosphorylation	VAFTGLVSAANSSNS HHHHHHHHHHCCCCC	27.06	19779198
25	Phosphorylation	SAANSSNSSSSKNAA HHHCCCCCCCCCCCC	33.28	19779198

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HOR7_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HOR7_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HOR7_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UPPS_YEAST	NUS1	genetic	16269340
BFR1_YEAST	BFR1	genetic	16269340
PLMT_YEAST	OPI3	genetic	16269340
SLG1_YEAST	SLG1	genetic	23891562
CSG2_YEAST	CSG2	genetic	23891562
PRP6_YEAST	PRP6	genetic	27708008
CDC20_YEAST	CDC20	genetic	27708008
CDC24_YEAST	CDC24	genetic	27708008
CKS1_YEAST	CKS1	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
TIM23_YEAST	TIM23	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.