| UniProt ID | TIM23_YEAST | |
|---|---|---|
| UniProt AC | P32897 | |
| Protein Name | Mitochondrial import inner membrane translocase subunit TIM23 | |
| Gene Name | TIM23 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 222 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . Around 20 amino acids of the N-terminus are believed to span the mitochondrial outer membrane. This association is dynamic and depends on the translocation activity of the TIM23 complex. Ho |
|
| Protein Description | Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.. | |
| Protein Sequence | MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHPLAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 143 | Acetylation | TVLNHITKRGPFLGN HHHHHHHCCCCCCCC | 55.55 | 24489116 | |
| 172 | Acetylation | TIDALRGKHDTAGSI HHHHHCCCCCCCCHH | 31.69 | 22865919 | |
| 190 | Acetylation | ALTGALFKSSKGLKP HHHHHHHHCCCCCCC | 55.45 | 22865919 | |
| 200 | Phosphorylation | KGLKPMGYSSAMVAA CCCCCCCHHHHHHHH | 8.00 | 27017623 | |
| 201 | Phosphorylation | GLKPMGYSSAMVAAA CCCCCCHHHHHHHHH | 13.09 | 27017623 | |
| 202 | Phosphorylation | LKPMGYSSAMVAAAC CCCCCHHHHHHHHHH | 16.35 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM23_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM23_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM23_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
