UniProt ID | ALLA_YEAST | |
---|---|---|
UniProt AC | P32459 | |
Protein Name | Ureidoglycolate lyase | |
Gene Name | DAL3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 195 | |
Subcellular Localization | ||
Protein Description | Catalyzes the catabolism of the allantoin degradation intermediate (S)-ureidoglycolate, generating urea and glyoxylate. Involved in the utilization of allantoin as secondary nitrogen source when primary sources are limiting.. | |
Protein Sequence | MVTVVAETLTKESFEEYGTIISPDEEISRMQNLEKGANQGTAIKLLQVSQVENKSTSKVPNWNLFRCFPQPHLNRVFTQGSNQAISHSIKVLEKHPCSTQTFVPMGRTSAEVAYLVVVAKEIGNKPDLSTLRAFTCLGNQAVTYGLGTWHAPMIVLGKEEHLDFSVLIYESLDPDRPEKDCVEEHYSDGDVCIII | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
98 | Phosphorylation | VLEKHPCSTQTFVPM EECCCCCCCCCEEEC | 28.18 | 27017623 | |
108 | Phosphorylation | TFVPMGRTSAEVAYL CEEECCCCCHHHEEE | 26.93 | 27017623 | |
109 | Phosphorylation | FVPMGRTSAEVAYLV EEECCCCCHHHEEEE | 22.52 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALLA_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALLA_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALLA_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...