| UniProt ID | TCPZ_YEAST | |
|---|---|---|
| UniProt AC | P39079 | |
| Protein Name | T-complex protein 1 subunit zeta | |
| Gene Name | CCT6 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 546 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. Known to play a role, in vitro, in the folding of actin and tubulin. In yeast may play a role in mitotic spindle formation.. | |
| Protein Sequence | MSLQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLKMLVDGAGNIKLTKDGKVLLTEMQIQSPTAVLIARAAAAQDEITGDGTTTVVCLVGELLRQAHRFIQEGVHPRIITDGFEIARKESMKFLDEFKISKTNLSNDREFLLQVARSSLLTKVDADLTEVLTPIVTDAVLSVYDAQADNLDLHMVEIMQMQHLSPKDTTFIKGLVLDHGGRHPDMPTRVKNAYVLILNVSLEYEKTEVNSGFFYSSADQRDKLAASERKFVDAKLKKIIDLKNEVCGMDPDKGFVIINQKGIDPMSLDVFAKHNILALRRAKRRNMERLQLVTGGEAQNSVEDLSPQILGFSGLVYQETIGEEKFTYVTENTDPKSCTILIKGSTHYALAQTKDAVRDGLRAVANVLKDKNIIPGAGAFYIALSRYLRSANMNKLGAKGKTKTGIEAFAEALLVIPKTLVKNSGFDPLDVLAMVEDELDDAQDSDETRYVGVDLNIGDSCDPTIEGIWDSYRVLRNAITGATGIASNLLLCDELLRAGRSTLKETPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSLQLLNPK ------CCCCCCCCC | 25.48 | 30377154 | |
| 2 | Acetylation | ------MSLQLLNPK ------CCCCCCCCC | 25.48 | 22814378 | |
| 9 | Ubiquitination | SLQLLNPKAESLRRD CCCCCCCCHHHHHHH | 64.81 | 24961812 | |
| 9 | Acetylation | SLQLLNPKAESLRRD CCCCCCCCHHHHHHH | 64.81 | 24489116 | |
| 40 | Ubiquitination | LETNLGPKGTLKMLV HHCCCCCCCEEEEEE | 63.83 | 23749301 | |
| 64 | Phosphorylation | KDGKVLLTEMQIQSP CCCCEEEEEEEECCC | 25.83 | 28889911 | |
| 70 | Phosphorylation | LTEMQIQSPTAVLIA EEEEEECCCHHHHHH | 26.33 | 28152593 | |
| 72 | Phosphorylation | EMQIQSPTAVLIARA EEEECCCHHHHHHHH | 34.35 | 29688323 | |
| 131 | Acetylation | IARKESMKFLDEFKI HHHHHHHHHHHCCCC | 52.64 | 24489116 | |
| 137 | Acetylation | MKFLDEFKISKTNLS HHHHHCCCCCCCCCC | 43.98 | 24489116 | |
| 211 | Acetylation | PKDTTFIKGLVLDHG CCCCCEEEEEECCCC | 41.84 | 24489116 | |
| 245 | Phosphorylation | VSLEYEKTEVNSGFF EEEEEECEEECCCCC | 32.97 | 22369663 | |
| 249 | Phosphorylation | YEKTEVNSGFFYSSA EECEEECCCCCCCCH | 42.00 | 22369663 | |
| 253 | Phosphorylation | EVNSGFFYSSADQRD EECCCCCCCCHHHHH | 10.23 | 22369663 | |
| 254 | Phosphorylation | VNSGFFYSSADQRDK ECCCCCCCCHHHHHH | 17.56 | 22369663 | |
| 255 | Phosphorylation | NSGFFYSSADQRDKL CCCCCCCCHHHHHHH | 25.20 | 22369663 | |
| 291 | Acetylation | VCGMDPDKGFVIINQ CCCCCCCCCEEEEEC | 60.69 | 24489116 | |
| 311 | Acetylation | MSLDVFAKHNILALR HHHHHHHHHHHHHHH | 26.22 | 24489116 | |
| 392 | Acetylation | HYALAQTKDAVRDGL CCEEHHCHHHHHHHH | 31.45 | 24489116 | |
| 542 | Ubiquitination | RAGRSTLKETPQ--- HHCHHHHHCCCC--- | 60.68 | 23749301 | |
| 544 | Phosphorylation | GRSTLKETPQ----- CHHHHHCCCC----- | 25.96 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCPZ_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCPZ_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCPZ_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70 AND SER-249, AND MASSSPECTROMETRY. | |
