| UniProt ID | REI1_YEAST | |
|---|---|---|
| UniProt AC | P38344 | |
| Protein Name | Cytoplasmic 60S subunit biogenesis factor REI1 | |
| Gene Name | REI1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 393 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Pre-60S-associated factor involved in the cytoplasmic maturation of the 60S subunit. Involved in the dissociation and recycling of other late pre-60S factors like ARX1, TIF6 and ALB1 before newly synthesized large ribosomal subunits enter translation. Cooperates with the co-chaperone JJJ1 in the release of the nuclear-export factor ARX1. May act redundantly with REH1 to directly promote a stabilizing structural rearrangement in cytoplasmic 60S subunit maturation independent on ARX1 recycling.. | |
| Protein Sequence | MSSSGVYTCNSCVLTFDSSDEQRAHMKSDWHRYNLKRRVAQLPPISFETFDSKVSAAAASTSKSAEKEKPVTKKELKRREKQALLEKKKKLLEIARANMLENMQKSQEGNTPDLSKLSLQENEENKEKEEPKKEEPEQLTEEEMAERVMQEKLRNRVDIPLEQCLFCEHNKHFKDVEENLEHMFRTHGFYIPEQKYLVDKIGLVKYMSEKIGLGNICIVCNYQGRTLTAVRQHMLAKRHCKIPYESEDERLEISEFYDFTSSYANFNSNTTPDNEDDWEDVGSDEAGSDDEDLPQEYLYNDGIELHLPTGIKVGHRSLQRYYKQDLKPEVILTEGQGTLVAAETRSFLPAFDKKGVQTQQRVWQTERFDKKRLDKRSAKFVNNQPHYRDQLLQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 55 | Phosphorylation | ETFDSKVSAAAASTS HHCCHHHHHHHHCCC | 18.87 | 29688323 | |
| 106 | Phosphorylation | MLENMQKSQEGNTPD HHHHHHHHCCCCCCC | 19.30 | 22369663 | |
| 111 | Phosphorylation | QKSQEGNTPDLSKLS HHHCCCCCCCHHHHH | 29.09 | 29136822 | |
| 115 | Phosphorylation | EGNTPDLSKLSLQEN CCCCCCHHHHHHHHC | 38.64 | 29136822 | |
| 118 | Phosphorylation | TPDLSKLSLQENEEN CCCHHHHHHHHCHHH | 31.57 | 29136822 | |
| 140 | Phosphorylation | KEEPEQLTEEEMAER CCCHHHCCHHHHHHH | 40.83 | 28889911 | |
| 171 | Ubiquitination | CLFCEHNKHFKDVEE HHHHCCCHHCCCHHH | 52.94 | 17644757 | |
| 195 | Ubiquitination | GFYIPEQKYLVDKIG CCCCCCHHCHHHHHH | 38.60 | 17644757 | |
| 195 | Acetylation | GFYIPEQKYLVDKIG CCCCCCHHCHHHHHH | 38.60 | 24489116 | |
| 205 | Acetylation | VDKIGLVKYMSEKIG HHHHHHHHHHHHHCC | 40.03 | 24489116 | |
| 210 | Ubiquitination | LVKYMSEKIGLGNIC HHHHHHHHCCCCCEE | 34.46 | 17644757 | |
| 246 | Phosphorylation | HCKIPYESEDERLEI CCCCCCCCHHHCEEE | 44.50 | 28889911 | |
| 346 | Phosphorylation | LVAAETRSFLPAFDK EEEEECHHCCCCCCC | 38.26 | 28889911 | |
| 379 | Acetylation | RLDKRSAKFVNNQPH HCCHHHHHHHCCCCC | 51.60 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of REI1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of REI1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of REI1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-140, AND MASSSPECTROMETRY. | |
