| UniProt ID | PIH1_YEAST | |
|---|---|---|
| UniProt AC | P38768 | |
| Protein Name | Protein interacting with Hsp90 1 | |
| Gene Name | PIH1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 344 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Involved in pre-rRNA processing and required for the NOP58-snoRNA interaction.. | |
| Protein Sequence | MADFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFINVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDYKAKMHKIIEEEAGDPMSILRGRNDDGDDNNDPDDGTLPPLFPIENKISGAKIEEIDKNEIAHRNLKQAPAPAPAPHEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPSYNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERTLYIYI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Ubiquitination | DFLLRPIKQRHRNED CCCCCCHHHHCCCCC | 43.92 | 24961812 | |
| 18 | Acetylation | QRHRNEDKYVSVDAA HHCCCCCCCEEEECC | 41.18 | 24489116 | |
| 19 | Phosphorylation | RHRNEDKYVSVDAAD HCCCCCCCEEEECCC | 15.41 | 27017623 | |
| 28 | Phosphorylation | SVDAADGSVSKIEPI EEECCCCCCCCCEEC | 24.62 | 27017623 | |
| 30 | Phosphorylation | DAADGSVSKIEPIAD ECCCCCCCCCEECHH | 29.61 | 27017623 | |
| 41 | Acetylation | PIADFVIKTKLLSAN ECHHHHHHHEEHHCC | 34.01 | 24489116 | |
| 199 | Phosphorylation | EEAGDPMSILRGRND HHCCCCCHHHCCCCC | 24.70 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIH1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIH1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIH1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
