UniProt ID | YBQ6_YEAST | |
---|---|---|
UniProt AC | P38081 | |
Protein Name | Uncharacterized glycosyl hydrolase YBR056W | |
Gene Name | YBR056W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 501 | |
Subcellular Localization | Mitochondrion intermembrane space . | |
Protein Description | ||
Protein Sequence | MIGSLRNKFEHFKVSEKGGQNLSTTLPKLPPAKDLDRSTIYKYRYNYGVNLGALFVLEPWIFSKETICTIDGKEYDSEFDAISQQLKKHSSEDVAKMLSDHYKKYIDRIDWEWLSKDAHITALRIPIGYWHVEDGKHLDSLPFAPLRKVYELAKPWEKLGELINNAKKMSIGVLIDLHGLPGGANCDSHSGSKSGEAAFFHKEKYMTKVYKDILPAIINTMTLGNENIIGIQVVNEACFDNNPKGQKFYYSEAINTVEKLQPGLPVIISDGWWPQQWADWVKEKHFSEIVVIDSHVYRCFSDSDKSKDANSIIKDLPNTVNFPHEDADYTVGEFSGVLDGQTWNKTSGDRDAIVQKYVQTQADVFSHVASWGWFFWTLQFEYGDGGEWGLAPMMQKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFEDGIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKKDSEFMWEWDQGYQRGLDEFNKY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MIGSLRNKFEH ----CCCCHHHHCCC | 17.15 | 28889911 | |
13 | Acetylation | RNKFEHFKVSEKGGQ HHHCCCCCCCCCCCC | 46.92 | 25381059 | |
75 | Phosphorylation | CTIDGKEYDSEFDAI EEECCEECHHHHHHH | 28.40 | 22369663 | |
77 | Phosphorylation | IDGKEYDSEFDAISQ ECCEECHHHHHHHHH | 38.98 | 22369663 | |
83 | Phosphorylation | DSEFDAISQQLKKHS HHHHHHHHHHHHHCC | 17.37 | 22369663 | |
87 | Acetylation | DAISQQLKKHSSEDV HHHHHHHHHCCHHHH | 44.07 | 24489116 | |
154 | Acetylation | RKVYELAKPWEKLGE HHHHHHHHHHHHHHH | 64.39 | 24489116 | |
207 | Phosphorylation | FHKEKYMTKVYKDIL EECHHHHHHHHHHHH | 17.80 | 27017623 | |
210 | Phosphorylation | EKYMTKVYKDILPAI HHHHHHHHHHHHHHH | 12.42 | 27017623 | |
311 | Phosphorylation | DKSKDANSIIKDLPN CCCCCCCHHHHCCCC | 27.66 | 27717283 | |
500 | Ubiquitination | RGLDEFNKY------ HCHHHHHCC------ | 58.62 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBQ6_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBQ6_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBQ6_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BUD31_YEAST | BUD31 | genetic | 27708008 | |
SAP1_YEAST | SAP1 | genetic | 27708008 | |
YIS7_YEAST | YIR007W | genetic | 27708008 | |
DAL81_YEAST | DAL81 | genetic | 27708008 | |
YKE44_YEAST | YKL044W | genetic | 27708008 | |
SSH4_YEAST | SSH4 | genetic | 27708008 | |
FRE2_YEAST | FRE2 | genetic | 27708008 | |
SRL3_YEAST | SRL3 | genetic | 27708008 | |
SWI6_YEAST | SWI6 | genetic | 27708008 | |
HMDH1_YEAST | HMG1 | genetic | 27708008 | |
VPS9_YEAST | VPS9 | genetic | 27708008 | |
MSC1_YEAST | MSC1 | genetic | 27708008 | |
PGM2_YEAST | PGM2 | genetic | 27708008 | |
GCSP_YEAST | GCV2 | genetic | 27708008 | |
ENB1_YEAST | ENB1 | genetic | 27708008 | |
UBP2_YEAST | UBP2 | genetic | 27708008 | |
KIN4_YEAST | KIN4 | genetic | 27708008 | |
BUD7_YEAST | BUD7 | genetic | 27708008 | |
TYE7_YEAST | TYE7 | genetic | 27708008 | |
YP078_YEAST | YPR078C | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...