| UniProt ID | TYE7_YEAST | |
|---|---|---|
| UniProt AC | P33122 | |
| Protein Name | Serine-rich protein TYE7 | |
| Gene Name | TYE7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 291 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional activator of glycolytic gene expression, such as enolase genes (ENO1 and ENO2), glyceraldehyde-3-phosphate dehydrogenase gene (TDH), phosphoglycerate kinase (PGK1), phosphoglycerate mutase (PGM1), pyruvate kinase (PYK1) and triosephosphate isomerase (TPI1) genes. Binds DNA on E-box motifs: 5'-CANNTG-3'.. | |
| Protein Sequence | MNSILDRNVRSSETTLIKPESEFDNWLSDENDGASHINVNKDSSSVLSASSSTWFEPLENIISSASSSSIGSPIEDQFISSNNEESALFPTDQFFSNPSSYSHSPEVSSSIKREEDDNALSLADFEPASLQLMPNMINTDNNDDSTPLKNEIELNDSFIKTNLDAKETKKRAPRKRLTPFQKQAHNKIEKRYRININTKIARLQQIIPWVASEQTAFEVGDSVKKQDEDGAETAATTPLPSAAATSTKLNKSMILEKAVDYILYLQNNERLYEMEVQRLKSEIDTLKQDQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MNSILDRNVR -----CCCCHHHCCC | 24.19 | 19823750 | |
| 11 | Phosphorylation | ILDRNVRSSETTLIK CHHHCCCCCCCEEEC | 28.39 | 22369663 | |
| 12 | Phosphorylation | LDRNVRSSETTLIKP HHHCCCCCCCEEECC | 28.53 | 22369663 | |
| 14 | Phosphorylation | RNVRSSETTLIKPES HCCCCCCCEEECCHH | 28.93 | 22369663 | |
| 15 | Phosphorylation | NVRSSETTLIKPESE CCCCCCCEEECCHHH | 23.57 | 22369663 | |
| 21 | Phosphorylation | TTLIKPESEFDNWLS CEEECCHHHHCCCCC | 52.68 | 22369663 | |
| 28 | Phosphorylation | SEFDNWLSDENDGAS HHHCCCCCCCCCCCC | 34.20 | 22369663 | |
| 35 | Phosphorylation | SDENDGASHINVNKD CCCCCCCCCEECCCC | 30.35 | 22369663 | |
| 104 | Phosphorylation | NPSSYSHSPEVSSSI CCCCCCCCCCHHHHC | 19.47 | 28889911 | |
| 157 | Phosphorylation | NEIELNDSFIKTNLD CEEECCHHHHHHCCC | 28.00 | 22369663 | |
| 178 | Phosphorylation | RAPRKRLTPFQKQAH HCCHHCCCHHHHHHH | 26.53 | 21440633 | |
| 224 | Ubiquitination | FEVGDSVKKQDEDGA EECCCCCCCCCCCCC | 48.98 | 17644757 | |
| 225 | Ubiquitination | EVGDSVKKQDEDGAE ECCCCCCCCCCCCCC | 61.91 | 17644757 | |
| 233 | Phosphorylation | QDEDGAETAATTPLP CCCCCCCCCCCCCCC | 22.51 | 22369663 | |
| 236 | Phosphorylation | DGAETAATTPLPSAA CCCCCCCCCCCCCHH | 26.87 | 25521595 | |
| 237 | Phosphorylation | GAETAATTPLPSAAA CCCCCCCCCCCCHHH | 20.36 | 22369663 | |
| 241 | Phosphorylation | AATTPLPSAAATSTK CCCCCCCCHHHCCCC | 37.92 | 22369663 | |
| 245 | Phosphorylation | PLPSAAATSTKLNKS CCCCHHHCCCCCCHH | 32.00 | 22369663 | |
| 246 | Phosphorylation | LPSAAATSTKLNKSM CCCHHHCCCCCCHHH | 20.86 | 22369663 | |
| 247 | Phosphorylation | PSAAATSTKLNKSMI CCHHHCCCCCCHHHH | 34.89 | 22369663 | |
| 248 | Ubiquitination | SAAATSTKLNKSMIL CHHHCCCCCCHHHHH | 50.24 | 17644757 | |
| 257 | Ubiquitination | NKSMILEKAVDYILY CHHHHHHHHHHHHHH | 50.71 | 17644757 | |
| 280 | Ubiquitination | EMEVQRLKSEIDTLK HHHHHHHHHHHHHHH | 48.51 | 17644757 | |
| 287 | Ubiquitination | KSEIDTLKQDQK--- HHHHHHHHHHCC--- | 54.65 | 17644757 | |
| 291 | Ubiquitination | DTLKQDQK------- HHHHHHCC------- | 71.27 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TYE7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TYE7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TYE7_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104; THR-233 ANDTHR-237, AND MASS SPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-233 AND THR-237, ANDMASS SPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-237, AND MASSSPECTROMETRY. | |