dbPTM

YAP8_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YAP8_YEAST
UniProt AC	Q06596
Protein Name	AP-1-like transcription factor YAP8
Gene Name	ARR1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	294
Subcellular Localization	Nucleus .
Protein Description	Transcription activator of genes coding for transmembrane transporters (ACR2 and ACR3) involved in resistance to arsenic oxide. Its transcription activity is greatly induced by arsenite in a dose-dependent manner..
Protein Sequence	MAKPRGRKGGRKPSLTPPKNKRAAQLRASQNAFRKRKLERLEELEKKEAQLTVTNDQIHILKKENELLHFMLRSLLTERNMPSDERNISKACCEEKPPTCNTLDGSVVLSSTYNSLEIQQCYVFFKQLLSVCVGKNCTVPSPLNSFDRSFYPIGCTNLSNDIPGYSFLNDAMSEIHTFGDFNGELDSTFLEFSGTEIKEPNNFITENTNAIETAAASMVIRQGFHPRQYYTVDAFGGDVLLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YAP8_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YAP8_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YAP8_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YAP8_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DOA1_YEAST	DOA1	genetic	20959818
CSK21_YEAST	CKA1	genetic	21127252
GCN4_YEAST	GCN4	genetic	22844089
PRS6A_YEAST	RPT5	physical	22875988
STP22_YEAST	STP22	physical	22875988
SGF29_YEAST	SGF29	physical	22875988
VPS54_YEAST	VPS54	physical	22875988
SCC2_YEAST	SCC2	physical	22875988
SIR4_YEAST	SIR4	physical	22875988
IVY1_YEAST	IVY1	physical	22875988
VAB2_YEAST	VAB2	physical	22875988
TSC11_YEAST	TSC11	physical	22875988
VFA1_YEAST	VFA1	physical	22875988
GCN20_YEAST	GCN20	physical	22875988
MED3_YEAST	PGD1	physical	22875988
VAM7_YEAST	VAM7	physical	22875988
CCM1_YEAST	CCM1	physical	22875988
KEL1_YEAST	KEL1	physical	22875988
NNF1_YEAST	NNF1	physical	22875988
NTR2_YEAST	NTR2	physical	22875988
SNF7_YEAST	SNF7	physical	22875988
YL031_YEAST	YLR031W	physical	22875988
PFD5_YEAST	GIM5	physical	22875988
CBF3B_YEAST	CEP3	physical	22875988
MPD2_YEAST	MPD2	physical	22875988
TBP6_YEAST	YTA6	physical	22875988
SPP1_YEAST	SPP1	physical	22875988
SSO1_YEAST	SSO1	physical	22875988
GYP5_YEAST	GYP5	physical	22875988
YP117_YEAST	YPR117W	physical	22875988
YAP8_YEAST	ARR1	physical	22875988
YAP8_YEAST	ARR1	physical	23661758
YAP8_YEAST	ARR1	physical	17200139
UFD2_YEAST	UFD2	physical	26276098
YCY0_YEAST	YCR090C	genetic	27708008
REI1_YEAST	REI1	genetic	27708008
SPO74_YEAST	SPO74	genetic	27708008
ILM1_YEAST	ILM1	genetic	27708008
SIC1_YEAST	SIC1	genetic	27708008
UPS1_YEAST	UPS1	genetic	27708008
BUL2_YEAST	BUL2	genetic	27708008
MED2_YEAST	MED2	physical	28188921
LSM6_YEAST	LSM6	genetic	29674565
CCW12_YEAST	CCW12	genetic	29674565
PUF6_YEAST	PUF6	genetic	29674565
VPS24_YEAST	VPS24	genetic	29674565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YAP8_YEAST

Related Literatures of Post-Translational Modification