| UniProt ID | YL031_YEAST | |
|---|---|---|
| UniProt AC | Q07978 | |
| Protein Name | Putative uncharacterized protein YLR031W | |
| Gene Name | YLR031W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 186 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MPVLNTRTSYPNIDFHGTKVSDVLDAFEFEKHDDPLRDKWNTLQFLEKSFESKFESASELIQGGELAAIKERNFQLAKLNNLCFRVRESIKRRQDLEKKLRTLSQDTDNELLFLMLENERRKKSSVIIEFLSEIIREKSKRLTAEEQGFVNQNEVKPLILDLSARINRLNSILETKNTCIRRLSNQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 104 | Phosphorylation | EKKLRTLSQDTDNEL HHHHHHHCCCCCCHH | 25.95 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL031_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL031_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL031_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KRE28_YEAST | KRE28 | physical | 18719252 | |
| YM11_YEAST | EPO1 | physical | 18719252 | |
| MSH1_YEAST | MSH1 | physical | 22875988 | |
| NOT3_YEAST | NOT3 | physical | 22875988 | |
| NNF1_YEAST | NNF1 | physical | 22875988 | |
| HSK3_YEAST | HSK3 | physical | 22875988 | |
| AF9_YEAST | YAF9 | physical | 22875988 | |
| TYE7_YEAST | TYE7 | physical | 22875988 | |
| GPR1_YEAST | GPR1 | genetic | 27708008 | |
| VAM7_YEAST | VAM7 | genetic | 27708008 | |
| VAM3_YEAST | VAM3 | genetic | 27708008 | |
| SRO7_YEAST | SRO7 | genetic | 27708008 | |
| SOK1_YEAST | SOK1 | genetic | 27708008 | |
| ADH4_YEAST | ADH4 | genetic | 27708008 | |
| VOA1_YEAST | VOA1 | genetic | 27708008 | |
| RL24B_YEAST | RPL24B | genetic | 27708008 | |
| TBP7_YEAST | YTA7 | genetic | 27708008 | |
| GEA1_YEAST | GEA1 | genetic | 27708008 | |
| ELM1_YEAST | ELM1 | genetic | 27708008 | |
| KTR2_YEAST | KTR2 | genetic | 27708008 | |
| TAL1_YEAST | TAL1 | genetic | 27708008 | |
| YL413_YEAST | INA1 | genetic | 27708008 | |
| MKS1_YEAST | MKS1 | genetic | 27708008 | |
| DYDC1_HUMAN | DYDC1 | physical | 27107014 | |
| MAGAB_HUMAN | MAGEA11 | physical | 27107014 | |
| RBP1_HUMAN | RALBP1 | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...