UniProt ID | YL031_YEAST | |
---|---|---|
UniProt AC | Q07978 | |
Protein Name | Putative uncharacterized protein YLR031W | |
Gene Name | YLR031W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 186 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPVLNTRTSYPNIDFHGTKVSDVLDAFEFEKHDDPLRDKWNTLQFLEKSFESKFESASELIQGGELAAIKERNFQLAKLNNLCFRVRESIKRRQDLEKKLRTLSQDTDNELLFLMLENERRKKSSVIIEFLSEIIREKSKRLTAEEQGFVNQNEVKPLILDLSARINRLNSILETKNTCIRRLSNQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
104 | Phosphorylation | EKKLRTLSQDTDNEL HHHHHHHCCCCCCHH | 25.95 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL031_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL031_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL031_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KRE28_YEAST | KRE28 | physical | 18719252 | |
YM11_YEAST | EPO1 | physical | 18719252 | |
MSH1_YEAST | MSH1 | physical | 22875988 | |
NOT3_YEAST | NOT3 | physical | 22875988 | |
NNF1_YEAST | NNF1 | physical | 22875988 | |
HSK3_YEAST | HSK3 | physical | 22875988 | |
AF9_YEAST | YAF9 | physical | 22875988 | |
TYE7_YEAST | TYE7 | physical | 22875988 | |
GPR1_YEAST | GPR1 | genetic | 27708008 | |
VAM7_YEAST | VAM7 | genetic | 27708008 | |
VAM3_YEAST | VAM3 | genetic | 27708008 | |
SRO7_YEAST | SRO7 | genetic | 27708008 | |
SOK1_YEAST | SOK1 | genetic | 27708008 | |
ADH4_YEAST | ADH4 | genetic | 27708008 | |
VOA1_YEAST | VOA1 | genetic | 27708008 | |
RL24B_YEAST | RPL24B | genetic | 27708008 | |
TBP7_YEAST | YTA7 | genetic | 27708008 | |
GEA1_YEAST | GEA1 | genetic | 27708008 | |
ELM1_YEAST | ELM1 | genetic | 27708008 | |
KTR2_YEAST | KTR2 | genetic | 27708008 | |
TAL1_YEAST | TAL1 | genetic | 27708008 | |
YL413_YEAST | INA1 | genetic | 27708008 | |
MKS1_YEAST | MKS1 | genetic | 27708008 | |
DYDC1_HUMAN | DYDC1 | physical | 27107014 | |
MAGAB_HUMAN | MAGEA11 | physical | 27107014 | |
RBP1_HUMAN | RALBP1 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...