| UniProt ID | KRE28_YEAST | |
|---|---|---|
| UniProt AC | Q04431 | |
| Protein Name | Spindle pole body component KRE28 | |
| Gene Name | KRE28 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 385 | |
| Subcellular Localization |
Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. Nucleus membrane Peripheral membrane protein Nucleoplasmic side. Chromosome, centromere, kinetochore. Localizes to the nuclear side of the spindle pole body. |
|
| Protein Description | Forms a kinetochore complex with SPC105 which is required for kinetochore binding by a discrete subset of kMAPs (BIM1, BIK1 and SLK19) and motors (CIN8, KAR3). Involved in kinetochore-microtubule binding and the spindle assembly checkpoint.. | |
| Protein Sequence | MDTGSASIKDYETVLTDIEDSIAVSSEEVLNNQELRLKNTLHEITSSILAINEENKFVNPLRNDESLDVEGKEVFVNPKILSAKIKEFNKLMELLKLTYLEQETLDYFFRFTLSSTKPLQLDSEKDPQFVKLNERVNDLKEEISNVQESKIEQIKAEIQETGHNFAERQDLINELYLEATGDIENCWDSLNELKNLTNKEDKNMMGEKDTILNSSDSDDFVEETYTNWQKLLFLQKQNQRLTKELKEMHEVKNQIIRKGEQSKKEDSGHLMANESELCQSINLLTKFWEKHFLLKGSKTTILNFEIFTQLGKVQFEIKDMQYIIAISLSDLKRPMIKDITILQKAGGNIVTDIEASSKFNNKYRNNTKVQIFEVMDDIISELTNE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MDTGSASIKD -----CCCCCCCCCC | 31.56 | 27717283 | |
| 5 | Phosphorylation | ---MDTGSASIKDYE ---CCCCCCCCCCHH | 22.42 | 27717283 | |
| 7 | Phosphorylation | -MDTGSASIKDYETV -CCCCCCCCCCHHHH | 31.69 | 27717283 | |
| 16 | Phosphorylation | KDYETVLTDIEDSIA CCHHHHCHHHHHHHC | 30.51 | 21440633 | |
| 26 | Phosphorylation | EDSIAVSSEEVLNNQ HHHHCCCCHHHHCCH | 31.04 | 21440633 | |
| 40 | Phosphorylation | QELRLKNTLHEITSS HHHHHHHHHHHHHHH | 28.09 | 28889911 | |
| 45 | Phosphorylation | KNTLHEITSSILAIN HHHHHHHHHHHHHHC | 17.28 | 19779198 | |
| 47 | Phosphorylation | TLHEITSSILAINEE HHHHHHHHHHHHCCC | 16.99 | 19779198 | |
| 215 | Phosphorylation | KDTILNSSDSDDFVE CCCCCCCCCCCCHHH | 39.81 | 27017623 | |
| 217 | Phosphorylation | TILNSSDSDDFVEET CCCCCCCCCCHHHHH | 40.81 | 27017623 | |
| 236 | Ubiquitination | QKLLFLQKQNQRLTK HHHHHHHHHHHHHHH | 54.05 | 24961812 | |
| 236 | Acetylation | QKLLFLQKQNQRLTK HHHHHHHHHHHHHHH | 54.05 | 24489116 | |
| 327 | Phosphorylation | MQYIIAISLSDLKRP CEEEEEEEHHHCCCC | 16.88 | 27017623 | |
| 340 | Phosphorylation | RPMIKDITILQKAGG CCCCCEEEEEHHCCC | 26.26 | 21126336 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRE28_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRE28_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRE28_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SP105_YEAST | SPC105 | physical | 16554755 | |
| HSP71_YEAST | SSA1 | physical | 19536198 | |
| SP105_YEAST | SPC105 | physical | 19893618 | |
| KRE28_YEAST | KRE28 | physical | 19893618 | |
| SRS2_YEAST | SRS2 | genetic | 21459050 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
