| UniProt ID | VAM3_YEAST | |
|---|---|---|
| UniProt AC | Q12241 | |
| Protein Name | Syntaxin VAM3 | |
| Gene Name | VAM3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 283 | |
| Subcellular Localization |
Vacuole membrane Single-pass type IV membrane protein. |
|
| Protein Description | Required for vacuolar assembly. Provides the t-SNARE function in a late step of the vacuolar assembly. Required for homotypic vacuole membrane fusion, autophagy and fusion of biosynthetic transport vesicles with the vacuole. Required for the delivery of alpha-factor receptor-ligand complexes to the vacuole.. | |
| Protein Sequence | MSFFDIEAQSSKGNSQQEPQFSTNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLKTPISPGTSKERKDIHPRTEAVRQDPESSYISIKVNEQSPLLHNEGQHQLQLQEEQEQQQQGLSQEELDFQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANKQLTRADQHQRDRNKCGKVTLIIIIVVCMVVLLAVLS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | FFDIEAQSSKGNSQQ CCCEEECCCCCCCCC | 40.85 | 28889911 | |
| 53 | Phosphorylation | KECTKIGSKRDSKEL HHHHHCCCCCCCHHH | 28.17 | 27017623 | |
| 96 | Acetylation | GKLSADFKNLKTKYQ CCCCHHHHHHHHHHH | 63.02 | 24489116 | |
| 108 | Phosphorylation | KYQSLQQSYNQRKSL HHHHHHHHHHHCHHC | 17.06 | 28889911 | |
| 123 | Phosphorylation | FPLKTPISPGTSKER CCCCCCCCCCCCHHH | 20.62 | 22369663 | |
| 126 | Phosphorylation | KTPISPGTSKERKDI CCCCCCCCCHHHCCC | 39.75 | 22369663 | |
| 127 | Phosphorylation | TPISPGTSKERKDIH CCCCCCCCHHHCCCC | 38.13 | 22369663 | |
| 137 | Phosphorylation | RKDIHPRTEAVRQDP HCCCCCCCHHHHCCC | 32.52 | 24961812 | |
| 146 | Phosphorylation | AVRQDPESSYISIKV HHHCCCCCCCEEEEE | 33.55 | 22369663 | |
| 147 | Phosphorylation | VRQDPESSYISIKVN HHCCCCCCCEEEEEC | 25.48 | 22369663 | |
| 148 | Phosphorylation | RQDPESSYISIKVNE HCCCCCCCEEEEECC | 14.15 | 22369663 | |
| 150 | Phosphorylation | DPESSYISIKVNEQS CCCCCCEEEEECCCC | 14.23 | 22369663 | |
| 229 | Phosphorylation | KEQGEQVTTIDENIS HHCCCEEEECCHHHH | 20.09 | 24961812 | |
| 230 | Phosphorylation | EQGEQVTTIDENISH HCCCEEEECCHHHHH | 27.81 | 24961812 | |
| 236 | Phosphorylation | TTIDENISHLHDNMQ EECCHHHHHHHHHHH | 31.42 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VAM3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAM3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAM3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-108, AND MASSSPECTROMETRY. | |
