| UniProt ID | FEN1_YEAST | |
|---|---|---|
| UniProt AC | P26793 | |
| Protein Name | Flap endonuclease 1 {ECO:0000255|HAMAP-Rule:MF_03140} | |
| Gene Name | RAD27 {ECO:0000255|HAMAP-Rule:MF_03140} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 382 | |
| Subcellular Localization | Nucleus, nucleolus. Nucleus, nucleoplasm. Mitochondrion. Resides mostly in the nucleoli and relocalizes to the nucleoplasm upon DNA damage. | |
| Protein Description | Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic/apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structurs that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double-stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA.. | |
| Protein Sequence | MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLAEATTELEKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAASEDMDTLCYRTPFLLRHLTFSEAKKEPIHEIDTELVLRGLDLTIEQFVDLCIMLGCDYCESIRGVGPVTALKLIKTHGSIEKIVEFIESGESNNTKWKIPEDWPYKQARMLFLDPEVIDGNEINLKWSPPKEKELIEYLCDDKKFSEERVKSGISRLKKGLKSGIQGRLDGFFQVVPKTKEQLAAAAKRAQENKKLNKNKNKVTKGRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Acetylation | AIRKSDIKSFFGRKV HHHHHHHHHHHCCCH | 46.32 | 24489116 | |
| 81 | Ubiquitination | RMIDNGIKPCYVFDG HHHHCCCCCEEEECC | 30.36 | 23749301 | |
| 110 | Acetylation | SRRVETEKKLAEATT HCHHHHHHHHHHHHH | 61.58 | 25381059 | |
| 116 | Phosphorylation | EKKLAEATTELEKMK HHHHHHHHHHHHHHH | 16.59 | 21126336 | |
| 193 | Phosphorylation | PFLLRHLTFSEAKKE HHHHHHCCCCHHCCC | 20.99 | 20190278 | |
| 246 | Acetylation | VGPVTALKLIKTHGS CCHHHHHHHHHHCCC | 45.78 | 24489116 | |
| 270 | Acetylation | SGESNNTKWKIPEDW CCCCCCCCCCCCCCC | 48.92 | 24489116 | |
| 352 | Acetylation | GFFQVVPKTKEQLAA CCEEECCCCHHHHHH | 61.70 | 25381059 | |
| 362 | Acetylation | EQLAAAAKRAQENKK HHHHHHHHHHHHHHH | 43.47 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FEN1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FEN1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FEN1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
