dbPTM

RRG8_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RRG8_YEAST
UniProt AC	Q06109
Protein Name	Required for respiratory growth protein 8, mitochondrial
Gene Name	RRG8
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	277
Subcellular Localization	Mitochondrion .
Protein Description	Required for respiratory activity and maintenance and expression of the mitochondrial genome..
Protein Sequence	MGLPKSAYKKLLIDCPTRVINKNCAQRVKDVSPLITNFEKWSDKRKKLYFKDEEEMVGQFHLENFNLKNNLYGRLLASPMRAEKISKLKSCRELLIPLKVVPSTGKDQHADKDKLKLVPTLDYSKSYKSSYVLNSASIVQDNLAAATSWFPISVLQTSTPKSLEVDSSTFITEYNANLHAFIKARLSVIPNVGPSSINRVLLICDKRKTPPIEIQVVSHGKGLPITQSVFNLGYLHEPTLEAIVSKDAVTNGIYLDADNDKDLIKHLYSTLLFHSVN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
120	Phosphorylation	DKLKLVPTLDYSKSY HHCEEEECCCCCCCC	25.45	29688323
123	Phosphorylation	KLVPTLDYSKSYKSS EEEECCCCCCCCCCE	22.55	29688323
124	Phosphorylation	LVPTLDYSKSYKSSY EEECCCCCCCCCCEE	18.13	29688323
135	Phosphorylation	KSSYVLNSASIVQDN CCEEEECCHHHHCCC	21.16	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RRG8_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RRG8_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RRG8_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VATB_YEAST	VMA2	physical	16554755
RRG1_YEAST	RRG1	physical	16554755
PT130_YEAST	PET130	physical	16554755
IRC19_YEAST	IRC19	physical	16554755
GEP5_YEAST	GEP5	physical	16554755
STM1_YEAST	STM1	physical	16554755
RPM2_YEAST	RPM2	physical	16554755

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RRG8_YEAST

Related Literatures of Post-Translational Modification