| UniProt ID | IRC19_YEAST | |
|---|---|---|
| UniProt AC | Q07843 | |
| Protein Name | Increased recombination centers protein 19 | |
| Gene Name | IRC19 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 230 | |
| Subcellular Localization | ||
| Protein Description | Involved in sporulation and maintenance of the mitochondrial DNA. Is probably involved in a pathway contributing to genomic integrity.. | |
| Protein Sequence | MRKPSITITTAKAIITPDYTLIKSHSKYQLPSRFQKLDADSPERSTVVKLFYRRFMRLKPFISNVKMVKDTYRDYVRYKFMKENYELKRYLVFNPDGLRSKINLELLSNTKCCERILPVTEMQRTLEFVLKSCSYLPETKVQKWDIARDNTYCRQILKNLLTMQYEKYRSILHRGIGHDELDVKFSHLKTTSSPLTKLNKTEKKKIPLFKVFSDFDTTLIYLNETLGTRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 190 | Phosphorylation | VKFSHLKTTSSPLTK HHHHCCCCCCCCCCC | 37.97 | 29136822 | |
| 191 | Phosphorylation | KFSHLKTTSSPLTKL HHHCCCCCCCCCCCC | 26.14 | 29136822 | |
| 192 | Phosphorylation | FSHLKTTSSPLTKLN HHCCCCCCCCCCCCC | 34.88 | 29136822 | |
| 193 | Phosphorylation | SHLKTTSSPLTKLNK HCCCCCCCCCCCCCH | 23.10 | 29136822 | |
| 196 | Phosphorylation | KTTSSPLTKLNKTEK CCCCCCCCCCCHHCC | 36.55 | 29136822 | |
| 201 | Phosphorylation | PLTKLNKTEKKKIPL CCCCCCHHCCCCCCC | 52.54 | 29136822 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IRC19_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IRC19_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IRC19_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...