UniProt ID | IRC19_YEAST | |
---|---|---|
UniProt AC | Q07843 | |
Protein Name | Increased recombination centers protein 19 | |
Gene Name | IRC19 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 230 | |
Subcellular Localization | ||
Protein Description | Involved in sporulation and maintenance of the mitochondrial DNA. Is probably involved in a pathway contributing to genomic integrity.. | |
Protein Sequence | MRKPSITITTAKAIITPDYTLIKSHSKYQLPSRFQKLDADSPERSTVVKLFYRRFMRLKPFISNVKMVKDTYRDYVRYKFMKENYELKRYLVFNPDGLRSKINLELLSNTKCCERILPVTEMQRTLEFVLKSCSYLPETKVQKWDIARDNTYCRQILKNLLTMQYEKYRSILHRGIGHDELDVKFSHLKTTSSPLTKLNKTEKKKIPLFKVFSDFDTTLIYLNETLGTRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
190 | Phosphorylation | VKFSHLKTTSSPLTK HHHHCCCCCCCCCCC | 37.97 | 29136822 | |
191 | Phosphorylation | KFSHLKTTSSPLTKL HHHCCCCCCCCCCCC | 26.14 | 29136822 | |
192 | Phosphorylation | FSHLKTTSSPLTKLN HHCCCCCCCCCCCCC | 34.88 | 29136822 | |
193 | Phosphorylation | SHLKTTSSPLTKLNK HCCCCCCCCCCCCCH | 23.10 | 29136822 | |
196 | Phosphorylation | KTTSSPLTKLNKTEK CCCCCCCCCCCHHCC | 36.55 | 29136822 | |
201 | Phosphorylation | PLTKLNKTEKKKIPL CCCCCCHHCCCCCCC | 52.54 | 29136822 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IRC19_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IRC19_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IRC19_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...