| UniProt ID | MPC2_YEAST | |
|---|---|---|
| UniProt AC | P38857 | |
| Protein Name | Mitochondrial pyruvate carrier 2 {ECO:0000303|PubMed:22628554, ECO:0000303|PubMed:22628558} | |
| Gene Name | MPC2 {ECO:0000303|PubMed:22628554, ECO:0000303|PubMed:22628558} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 129 | |
| Subcellular Localization |
Mitochondrion . Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | Mediates the uptake of pyruvate into mitochondria.. | |
| Protein Sequence | MSTSSVRFAFRRFWQSETGPKTVHFWAPTLKWGLVFAGFSDMKRPVEKISGAQNLSLLSTALIWTRWSFVIKPRNILLASVNSFLCLTAGYQLGRIANYRIRNGDSISQLCSYILSGADESKKEITTGR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 99 | Phosphorylation | QLGRIANYRIRNGDS HHHCCCCCCCCCCCH | 9.82 | 25533186 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPC2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPC2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPC2_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MPC3_YEAST | MPC3 | physical | 22628558 | |
| MDL2_YEAST | MDL2 | physical | 22628558 | |
| NDH1_YEAST | NDE1 | physical | 22628558 | |
| QCR1_YEAST | COR1 | physical | 22628558 | |
| GPDM_YEAST | GUT2 | physical | 22628558 | |
| QCR2_YEAST | QCR2 | physical | 22628558 | |
| MPC2_YEAST | MPC2 | physical | 22628558 | |
| MPC1_YEAST | MPC1 | physical | 22628558 | |
| MPC3_YEAST | MPC3 | genetic | 22628554 | |
| MPC1_YEAST | MPC1 | physical | 22628554 | |
| SSB1_YEAST | SSB1 | physical | 22940862 | |
| MPC1_YEAST | MPC1 | physical | 24244496 | |
| GLRX7_YEAST | GRX7 | genetic | 27708008 | |
| SEC66_YEAST | SEC66 | genetic | 27708008 | |
| RV161_YEAST | RVS161 | genetic | 27708008 | |
| PEX19_YEAST | PEX19 | genetic | 27708008 | |
| ARO1_YEAST | ARO1 | genetic | 27708008 | |
| WDR59_YEAST | MTC5 | genetic | 27708008 | |
| ICE2_YEAST | ICE2 | genetic | 27708008 | |
| MAOM_YEAST | MAE1 | genetic | 27708008 | |
| VAC14_YEAST | VAC14 | genetic | 27708008 | |
| PFKA2_YEAST | PFK2 | genetic | 27708008 | |
| TMA23_YEAST | TMA23 | genetic | 27708008 | |
| VAM10_YEAST | VAM10 | genetic | 27708008 | |
| LGE1_YEAST | LGE1 | genetic | 27708008 | |
| PRM4_YEAST | PRM4 | genetic | 27708008 | |
| PCL8_YEAST | PCL8 | genetic | 27708008 | |
| AXL1_YEAST | AXL1 | genetic | 27708008 | |
| MPC1_YEAST | MPC1 | physical | 25672363 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
