UniProt ID | TMA23_YEAST | |
---|---|---|
UniProt AC | Q03525 | |
Protein Name | Protein TMA23 | |
Gene Name | TMA23 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 211 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Trans-acting factors of the ribosome biogenesis process.. | |
Protein Sequence | MDSKEYLISYGWKEGEAFREGGLKRPILVKHKRDKKGLGNAPGGNDGEAWWERLFDGHLKNLDVSTDSNNGSIKFTQNEAVATAVSKSSSPLYRWFVKGEGLKGTITNLGKKEEASFVVSSASSSKGKKRRRRDEDDNKVKRKKLKKDKKTSNDSESKKKKKKKSKKESKKGKKSKHSSDEGDKSKHKKSKKSKKHKKEESSARRDRKEHI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MDSKEYLISY -----CCCHHHHHHC | 26.53 | 30377154 | |
30 | Acetylation | LKRPILVKHKRDKKG CCCCEEEEECCCCCC | 39.71 | 25381059 | |
68 | Phosphorylation | NLDVSTDSNNGSIKF CEEECCCCCCCEEEE | 32.08 | 30377154 | |
72 | Phosphorylation | STDSNNGSIKFTQNE CCCCCCCEEEEECCH | 25.40 | 30377154 | |
90 | Phosphorylation | TAVSKSSSPLYRWFV HHHHCCCCCCCHHHH | 26.47 | 21440633 | |
178 | Phosphorylation | KGKKSKHSSDEGDKS HCCCCCCCCCCCCHH | 43.13 | 19795423 | |
179 | Phosphorylation | GKKSKHSSDEGDKSK CCCCCCCCCCCCHHH | 39.13 | 19795423 | |
201 | Phosphorylation | KKHKKEESSARRDRK HHHHHHHHHHHHHHH | 30.32 | 27717283 | |
202 | Phosphorylation | KHKKEESSARRDRKE HHHHHHHHHHHHHHH | 29.13 | 27717283 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMA23_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMA23_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMA23_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...