| UniProt ID | LGE1_YEAST | |
|---|---|---|
| UniProt AC | Q02796 | |
| Protein Name | Transcriptional regulatory protein LGE1 | |
| Gene Name | LGE1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 332 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Required to activate transcription of PDR3, a gene involved in retrograde regulation of multidrug resistance, a phenomenon that takes place in cells that have lost their mitochondrial genome. Also required for ubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. Its precise role in H2BK123ub1 formation however is unclear and is independent of retrograde regulation of multidrug resistance function.. | |
| Protein Sequence | MSGYTGNNYSRYSSTPPRQRGGYHHARRSRGGAGGSYYRGGNASYGARYNSDYEQPPQEGDLRQTGAYYRNGYTDTRPYYSANSRHYQAQPSPRYNNGTNSYHLPQRGNSQDTNGRTTSASQEDNDEKRVKSRYRNMQADHPRQQPMSVGSTSSRNGSSGNSSTSSTSNGLPPPPSVSSITNNRSYHSSAYPYSSSHTYNNYHHRETPPPPPSNGYYAKGYPVHVPENRSNSDGSSSSVVKKKRILDMKDSPFIYLTDFDKNVKKTNNTESECEKAREVFKESDSIDSALEELNLKINSNELELRLLNNQCDKHALNIQLTQEKLDSLLLMQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSGYTGNNY ------CCCCCCCCC | 40.27 | 30377154 | |
| 4 | Phosphorylation | ----MSGYTGNNYSR ----CCCCCCCCCCC | 12.27 | 28889911 | |
| 5 | Phosphorylation | ---MSGYTGNNYSRY ---CCCCCCCCCCCC | 36.64 | 28889911 | |
| 9 | Phosphorylation | SGYTGNNYSRYSSTP CCCCCCCCCCCCCCC | 9.87 | 30377154 | |
| 10 | Phosphorylation | GYTGNNYSRYSSTPP CCCCCCCCCCCCCCC | 27.19 | 30377154 | |
| 13 | Phosphorylation | GNNYSRYSSTPPRQR CCCCCCCCCCCCHHC | 26.99 | 28889911 | |
| 14 | Phosphorylation | NNYSRYSSTPPRQRG CCCCCCCCCCCHHCC | 35.68 | 28889911 | |
| 15 | Phosphorylation | NYSRYSSTPPRQRGG CCCCCCCCCCHHCCC | 31.22 | 28889911 | |
| 49 | Phosphorylation | NASYGARYNSDYEQP CCCCCCCCCCCCCCC | 20.63 | 30377154 | |
| 51 | Phosphorylation | SYGARYNSDYEQPPQ CCCCCCCCCCCCCCC | 32.41 | 28889911 | |
| 92 | Phosphorylation | RHYQAQPSPRYNNGT CCCCCCCCCCCCCCC | 15.21 | 28889911 | |
| 110 | Phosphorylation | HLPQRGNSQDTNGRT CCCCCCCCCCCCCCC | 32.05 | 27214570 | |
| 121 | Phosphorylation | NGRTTSASQEDNDEK CCCCCCCCHHCCHHH | 33.59 | 28889911 | |
| 151 | Phosphorylation | QQPMSVGSTSSRNGS CCCCCCCCCCCCCCC | 23.98 | 30377154 | |
| 154 | Phosphorylation | MSVGSTSSRNGSSGN CCCCCCCCCCCCCCC | 29.83 | 28889911 | |
| 207 | Phosphorylation | NNYHHRETPPPPPSN CCCCCCCCCCCCCCC | 40.84 | 28889911 | |
| 221 | Phosphorylation | NGYYAKGYPVHVPEN CCCCCCCEEEECCCC | 11.02 | 19823750 | |
| 230 | Phosphorylation | VHVPENRSNSDGSSS EECCCCCCCCCCCCC | 52.87 | 21440633 | |
| 232 | Phosphorylation | VPENRSNSDGSSSSV CCCCCCCCCCCCCHH | 44.59 | 25752575 | |
| 235 | Phosphorylation | NRSNSDGSSSSVVKK CCCCCCCCCCHHHEE | 31.85 | 19823750 | |
| 236 | Phosphorylation | RSNSDGSSSSVVKKK CCCCCCCCCHHHEEE | 31.96 | 21440633 | |
| 237 | Phosphorylation | SNSDGSSSSVVKKKR CCCCCCCCHHHEEEE | 28.93 | 19823750 | |
| 238 | Phosphorylation | NSDGSSSSVVKKKRI CCCCCCCHHHEEEEE | 32.64 | 19823750 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LGE1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LGE1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LGE1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-232, AND MASSSPECTROMETRY. | |
