| UniProt ID | CDC31_YEAST | |
|---|---|---|
| UniProt AC | P06704 | |
| Protein Name | Cell division control protein 31 | |
| Gene Name | CDC31 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 161 | |
| Subcellular Localization | Nucleus, nuclear pore complex. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. Spindle pole body, SPB half- bridge. | |
| Protein Description | Functions as a component of the nuclear pore complex (NPC) and the spindle pole body (SPB) half-bridge. At the SPB, it is recruited by KAR1 and MPS3 to the SPB half-bridge and involved in the initial steps of SPB duplication. It probably plays a similar role in de novo assembly of NPCs at the nuclear envelope. Also involved in connection with the protein kinase KIC1 in the maintenance of cell morphology and integrity.. | |
| Protein Sequence | MSKNRSSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MSKNRSSLQSGPL --CCCCHHHHHCCCC | 44.81 | 22369663 | |
| 7 | Phosphorylation | -MSKNRSSLQSGPLN -CCCCHHHHHCCCCC | 27.47 | 22369663 | |
| 10 | Phosphorylation | KNRSSLQSGPLNSEL CCHHHHHCCCCCHHH | 47.90 | 22369663 | |
| 15 | Phosphorylation | LQSGPLNSELLEEQK HHCCCCCHHHHHHHH | 36.99 | 21700874 | |
| 70 | Phosphorylation | DLIDEYDSEGRHLMK HHHHHCCCCCCCCCC | 40.84 | 19779198 | |
| 110 | Phosphorylation | QLFDDDHTGKISIKN HHHCCCCCCCEEHHH | 47.36 | 28889911 | |
| 128 | Phosphorylation | VAKELGETLTDEELR HHHHHHCCCCHHHHH | 32.91 | 22369663 | |
| 130 | Phosphorylation | KELGETLTDEELRAM HHHHCCCCHHHHHHH | 49.11 | 22369663 | |
| 161 | Phosphorylation | FIAICTDS------- EEEEEECC------- | 24.78 | 21700874 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDC31_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDC31_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDC31_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-130, AND MASSSPECTROMETRY. | |
