| UniProt ID | SEM1_YEAST | |
|---|---|---|
| UniProt AC | O94742 | |
| Protein Name | 26S proteasome complex subunit SEM1 | |
| Gene Name | SEM1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 89 | |
| Subcellular Localization | ||
| Protein Description | Versatile protein that might stabilize multiple protein complexes involved in diverse pathways. Subunit of the 26S proteasome which plays a role in ubiquitin-dependent proteolysis. Associates also with the TREX-2 complex that is required for transcription-coupled mRNA export, and the COP9 signalosome, which is involved in deneddylation.. | |
| Protein Sequence | MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSTDVAAAQ ------CCHHHHHHH | 33.06 | 15665377 | |
| 2 | Phosphorylation | ------MSTDVAAAQ ------CCHHHHHHH | 33.06 | 24909858 | |
| 3 | Phosphorylation | -----MSTDVAAAQA -----CCHHHHHHHH | 32.94 | 28132839 | |
| 12 | Phosphorylation | VAAAQAQSKIDLTKK HHHHHHHHHHCCCHH | 34.30 | 22369663 | |
| 13 | Acetylation | AAAQAQSKIDLTKKK HHHHHHHHHCCCHHH | 28.32 | 22865919 | |
| 17 | Phosphorylation | AQSKIDLTKKKNEEI HHHHHCCCHHHCHHH | 36.75 | 24961812 | |
| 28 | Phosphorylation | NEEINKKSLEEDDEF CHHHHHHHCCCCCCC | 42.49 | 27017623 | |
| 42 | Phosphorylation | FEDFPIDTWANGETI CCCCCCCCCCCCCEE | 27.48 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEM1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEM1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEM1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...