dbPTM

3HAO_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	3HAO_YEAST
UniProt AC	P47096
Protein Name	3-hydroxyanthranilate 3,4-dioxygenase {ECO:0000255\|HAMAP-Rule:MF_03019}
Gene Name	BNA1 {ECO:0000255\|HAMAP-Rule:MF_03019}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	177
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Catalyzes the oxidative ring opening of 3-hydroxyanthranilate to 2-amino-3-carboxymuconate semialdehyde, which spontaneously cyclizes to quinolinate..
Protein Sequence	MFNTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQKKGSMLLKVVDETDAEPKFIDIIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGENDKIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARPQSN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
60	Ubiquitination	TPEWFYQKKGSMLLK CCHHHHCCCCCEEEE	47.96	23749301
67	Ubiquitination	KKGSMLLKVVDETDA CCCCEEEEEECCCCC	35.93	23749301
98	Phosphorylation	LPGNVPHSPVRFADT CCCCCCCCCCCCCCE	21.01	22369663
121	Acetylation	RPGGENDKIRWYCSH CCCCCCCCEEEEHHH	45.83	24489116
160	Acetylation	DFENDVEKRTCFHCK HCCCCCHHCEEEEEE	53.51	24489116
167	Ubiquitination	KRTCFHCKTLNYARP HCEEEEEEECCCCCC	47.69	22817900
167	Acetylation	KRTCFHCKTLNYARP HCEEEEEEECCCCCC	47.69	24489116
168	Phosphorylation	RTCFHCKTLNYARPQ CEEEEEEECCCCCCC	26.15	21126336
176	Phosphorylation	LNYARPQSN------ CCCCCCCCC------	47.38	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of 3HAO_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of 3HAO_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of 3HAO_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
3HAO_YEAST	BNA1	physical	16522801
GAP1_YEAST	GAP1	genetic	16941010
LYP1_YEAST	LYP1	genetic	16941010
LYS12_YEAST	LYS12	genetic	16941010
HOSC_YEAST	LYS20	genetic	16941010
LYS4_YEAST	LYS4	genetic	16941010
VHS1_YEAST	VHS1	physical	21460040
TNA1_YEAST	TNA1	genetic	21623372
NPT1_YEAST	NPT1	genetic	21623372
ACON2_YEAST	ACO2	genetic	21623372
FOLE_YEAST	MET7	genetic	21623372
THDH_YEAST	ILV1	genetic	21623372
PNC1_YEAST	PNC1	genetic	22539348
CND2_YEAST	BRN1	genetic	27708008
RSP5_YEAST	RSP5	genetic	27708008
CLP1_YEAST	CLP1	genetic	27708008
SNU23_YEAST	SNU23	genetic	27708008
UBC3_YEAST	CDC34	genetic	27708008
CDC37_YEAST	CDC37	genetic	27708008
ERF3_YEAST	SUP35	genetic	27708008
PCF11_YEAST	PCF11	genetic	27708008
SMD1_YEAST	SMD1	genetic	27708008
TEL2_YEAST	TEL2	genetic	27708008
MED6_YEAST	MED6	genetic	27708008
RSC9_YEAST	RSC9	genetic	27708008
PEX19_YEAST	PEX19	genetic	27708008
RTG2_YEAST	RTG2	genetic	27708008
TNA1_YEAST	TNA1	genetic	27708008
SNF6_YEAST	SNF6	genetic	27708008
MRT4_YEAST	MRT4	genetic	27708008
FRE2_YEAST	FRE2	genetic	27708008
UBX2_YEAST	UBX2	genetic	27708008
SCS7_YEAST	SCS7	genetic	27708008
NPT1_YEAST	NPT1	genetic	27708008
RS10A_YEAST	RPS10A	genetic	27708008
NEW1_YEAST	NEW1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of 3HAO_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, AND MASSSPECTROMETRY.	18407956 [Abstract]
"Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, AND MASSSPECTROMETRY.	17330950 [Abstract]
"Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-176, AND MASSSPECTROMETRY.	15665377 [Abstract]