| UniProt ID | SCS7_YEAST | |
|---|---|---|
| UniProt AC | Q03529 | |
| Protein Name | Ceramide very long chain fatty acid hydroxylase SCS7 | |
| Gene Name | SCS7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 384 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Ceramide hydroxylase involved in the alpha-hydroxylation of sphingolipid-associated very long chain fatty acids. Hydroxylates the very long chain fatty acid of ceramides at C2 and C3.. | |
| Protein Sequence | MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVFGTYLGPDAPLSKMKYE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSTNTSKTL ------CCCCCHHHH | 30.30 | 19795423 | |
| 3 | Phosphorylation | -----MSTNTSKTLE -----CCCCCHHHHH | 41.01 | 19795423 | |
| 5 | Phosphorylation | ---MSTNTSKTLELF ---CCCCCHHHHHHH | 31.52 | 19795423 | |
| 6 | Phosphorylation | --MSTNTSKTLELFS --CCCCCHHHHHHHH | 26.22 | 19795423 | |
| 7 | Ubiquitination | -MSTNTSKTLELFSK -CCCCCHHHHHHHHH | 55.90 | 24961812 | |
| 8 | Phosphorylation | MSTNTSKTLELFSKK CCCCCHHHHHHHHHC | 25.82 | 28889911 | |
| 13 | Phosphorylation | SKTLELFSKKTVQEH HHHHHHHHHCCHHHC | 45.96 | 21440633 | |
| 14 | Ubiquitination | KTLELFSKKTVQEHN HHHHHHHHCCHHHCC | 45.16 | 17644757 | |
| 15 | Ubiquitination | TLELFSKKTVQEHNT HHHHHHHCCHHHCCC | 53.37 | 17644757 | |
| 34 | Ubiquitination | WVTYQNRKIYDVTRF EEEECCCEEEEHHHH | 53.84 | 23749301 | |
| 51 | Phosphorylation | EHPGGDESILDYAGK CCCCCCHHHHHHCCC | 32.94 | 20377248 | |
| 58 | Ubiquitination | SILDYAGKDITEIMK HHHHHCCCCHHHHHH | 37.47 | 17644757 | |
| 131 | Ubiquitination | KELPAEEKLSIATDY EECCHHHCCCEECCC | 38.75 | 17644757 | |
| 131 | Acetylation | KELPAEEKLSIATDY EECCHHHCCCEECCC | 38.75 | 24489116 | |
| 143 | Ubiquitination | TDYSNDYKKHKFLDL CCCCCCHHHCCHHCC | 51.79 | 17644757 | |
| 143 | Acetylation | TDYSNDYKKHKFLDL CCCCCCHHHCCHHCC | 51.79 | 24489116 | |
| 144 | Ubiquitination | DYSNDYKKHKFLDLN CCCCCHHHCCHHCCC | 45.88 | 17644757 | |
| 146 | Ubiquitination | SNDYKKHKFLDLNRP CCCHHHCCHHCCCHH | 57.40 | 23749301 | |
| 164 | Ubiquitination | QILRSDFKKDFYVDQ HHHHHCCCCCEEECC | 57.32 | 22817900 | |
| 165 | Ubiquitination | ILRSDFKKDFYVDQI HHHHCCCCCEEECCC | 53.73 | 22817900 | |
| 180 | Ubiquitination | HRPRHYGKGSAPLFG CCCCCCCCCCCCCCH | 42.39 | 17644757 | |
| 180 | Acetylation | HRPRHYGKGSAPLFG CCCCCCCCCCCCCCH | 42.39 | 24489116 | |
| 195 | Ubiquitination | NFLEPLTKTAWWVVP HHHHHCCCCCCCHHH | 43.88 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCS7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCS7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCS7_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
